KEGG   Apis mellifera (honey bee): 408426Help
Entry
408426            CDS       T01057                                 

Gene name
Ppt2, GB11628
Definition
palmitoyl-protein thioesterase 2
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ame  Apis mellifera (honey bee)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    408426 (Ppt2)
  Lipid metabolism
   00062 Fatty acid elongation
    408426 (Ppt2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    408426 (Ppt2)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     408426 (Ppt2)
Lipid biosynthesis proteins [BR:ame01004]
 Fatty acid synthase
  Component type
   408426 (Ppt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG13
AA seq 240 aa AA seqDB search
MHPGTQVYNTPRYAGWSSLESMWRQVEEIGMDVISVGAAFPEGINLVGYSQGGLLARAIL
QTFPEHNVRNFISLSSPQAGQYGTRFLHLFFPDLVCETAYELFYSKIGQHTSIGNYWNDP
HHQKLYYKYSNFLPYVNNEKNSTKLSAFKEGLTKLKRMVLVGGPEDGVITPWQSSHFGYY
DDNETVINMRDRSIYKDDLIGLKTLDENGRLVLITVPNVPHYEWHKNISIVDDFLLPYLD
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcatccaggaacacaggtttataatactccaagatatgccggatggagtagtctggaa
tcgatgtggcgccaagtggaagaaataggcatggatgttatatccgttggtgctgcattt
cctgagggaataaatttagttggttatagtcaaggtggtttattagccagagcaatatta
caaacatttcctgaacacaatgtcagaaattttatttccttgagctcaccacaagcggga
caatatggaactcgatttcttcatttatttttccccgacttggtgtgtgaaactgcctat
gaattattttattcaaaaattggacaacataccagtattggcaattactggaatgatcct
catcatcaaaaattatactataaatatagtaattttttaccatatgtgaataatgaaaaa
aattcgacgaaattgtcagcatttaaagagggtctcaccaaattaaaacgtatggtactt
gttggtggacctgaggatggtgttattactccatggcaaagcagtcatttcggatattac
gatgataacgaaactgtgataaatatgcgtgatcgaagtatttacaaagatgatttaatt
ggactaaaaacattagatgaaaatggacgattagttctcatcacagtgccaaatgttcct
cattatgaatggcataaaaatatatccatagtagatgactttttactgccatatttagat
taa

DBGET integrated database retrieval system