KEGG   Apis mellifera (honey bee): 408438Help
Entry
408438            CDS       T01057                                 

Gene name
IRS, GB11037, InRS, chico
Definition
(RefSeq) insulin receptor substrate
  KO
K16172  
insulin receptor substrate 1
Organism
ame  Apis mellifera (honey bee)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Insulin resistance
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    408438 (IRS)
   04150 mTOR signaling pathway
    408438 (IRS)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    408438 (IRS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG13
AA seq 1219 aa AA seqDB search
MSSSRGLVSPSGGPVVLCGHVKKLKTQKKKYFVLRGEAPGYPACLEYYDSKKKFENRQPP
KRSILLDSCFNINRRVDTKHKHVIALYTKDECFCLILESEKELDEWLKAMLLLQSGDVAD
GEQPRPIFEHVWQVTMQKKGLGERKNIHGPYRLCLTDRTLSLVKIGAKDNSDSIEFPLIC
IRRCGYMDRIFYMEVGRSAVTGGGELWMEAEDNNIAHNMHAAIMNSMSNSSSSKDDVGPR
QRVRSSSATEASKPIFVLPHRYTGQRFYNSPLEEHRTHEEQVDPVQDQEQSNQTQSTSSC
NTITVVAGTGAGGTAGIASTNTNCATTARRRHSVASQPHSINNSQSVHVTTTSTTTTTTT
TITITMTATVTTTTTTATISHQRTLSLPLAAIINQMQSSKRSVLRCANGRDRCDSLPSRG
RTTSESHPTSIISHPRSSHFVSHVMRPHSMYVKGVSYSPPISSMPISPASGACSTDSAGS
SLSMDDGGENVLEEGTVSRYGHSLTPDEPVILEENGDDYAPWSTSHSHHKYSPNFKSHSP
SQQSSYLEMCSPCGSSPGPSGAYMPMSSGTGHSHSRGSSLVEESNTLPEGYVPMAPVGNN
GYVDMDPSHNHNGHFPDDLSHGGSSCSVTSGTPSTDLRFSEYHLDKVTSFLPPGDDLQAR
PARAYSIGSRPEPIKSHRKNRLDITQQDVSRVRAFSVGSRSKKPELGKLVNVVTAPLPVG
CENSSSNKSNSAPLLSSSWGHNSGCSITSERMEDLMELDFTKPSISTTFNSPPSSYSQPQ
SQSHSFSTATDTSSYVDMSPGQPPSSTTAPYVDMSRINKINRNNNNNTITANQNHSHIHV
SSSASIHKPVITTLKPVEEAEGPYMRMDGIMEDWSQSGSSPKLISSPMQEESVQSNGPPG
ATRTAPVDLPRRPPADYVDMNFKPRTSLEQDYINMNMSNRNNRKPMATRTGSRKEKSRSQ
PIAIQAGNKPIKTPSFLPLNGSPESESLASTPASPPRATPTGSSATIFPFSLNSPQSPEK
SFTHQKNTDELKPSELNMNLKHNNDRTIADATNGRVSTINSISVTDANSSTLSKVMIKDR
ASSPTGKDNQVNRIISNNSLTSQDNTLNNVTKKFSDLNVSKPRLITASPNTSPTLSGFKP
TIEKQPSSPKLPDETPTPTPTAMPSPLEKENFDKVQAAAEILHYASLDLPEVGNAAPMSP
ASQEGFNYAKIDFAKLKQN
NT seq 3660 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgagcaggggtttagtctccccttcaggaggtcccgttgttctctgcggtcac
gtgaagaaactaaagactcaaaagaaaaagtactttgtactgcgtggcgaagcaccagga
tatccagcatgtcttgaatattatgatagtaaaaagaaatttgaaaacagacaaccaccg
aaacgtagcattttattggacagttgctttaatattaatagacgcgtagatactaaacac
aaacatgttattgcattatatacgaaagatgaatgcttttgcttaattctggagagtgaa
aaagaactggatgaatggttaaaagcgatgcttttacttcagagcggagatgtagctgat
ggagagcaacctcggcctatatttgaacacgtatggcaagttacaatgcaaaaaaaggga
ttaggtgaacgaaagaatattcatggtccctatagactatgtttaactgatagaacatta
agcctagtaaaaattggagcaaaggataattcagattctatagaatttcctctaatttgc
atcagaagatgtggatatatggatcgtattttctatatggaagtaggtcgttcagcagtc
actggtggtggtgaattgtggatggaagctgaagacaacaatattgcacataatatgcat
gctgctattatgaattctatgagcaattctagtagcagtaaagatgatgtgggaccacgt
caaagagtgcgtagttcttctgctactgaagctagcaagccaatttttgtattaccacat
cgatatactggacaaagattctataattcaccattagaggaacacaggacgcacgaggag
caggtggacccagttcaagatcaagagcagtctaatcagactcagagtacctcttcttgc
aatacaatcacggtcgttgctggtaccggggctggtgggactgctgggattgcctcgact
aataccaactgtgccactaccgctagacgtcgtcattcggtagcgagtcaaccccattcc
atcaataattcccaatccgttcatgttacaacaacaagtacaactacaacaactaccact
actattaccatcactatgaccgctaccgtgaccaccacaaccacaaccgcgacaatatcc
catcagagaaccttgtcgctgcccttagctgccattatcaatcaaatgcaatcatctaaa
agatcagttttacgctgtgcaaatgggcgtgacagatgtgacagcttgccatcgaggggt
cgtactaccagcgaaagtcatccaacatcgataataagccatcctaggagttctcatttt
gtttctcatgtgatgagaccgcattctatgtacgtgaaaggcgtttcctattcaccgcca
atctcttcgatgcctattagtcctgcttccggtgcgtgttccacggattctgcaggatcc
tctctttcaatggatgatggtggtgaaaatgtgttggaagagggtactgtttcaagatat
ggacattctttgacgcctgacgaacctgttattctggaggaaaatggcgacgattatgct
ccgtggtccacatcacattcgcatcataaatattcaccaaattttaaatctcattctcct
tcccagcaaagttcctatttagaaatgtgtagtccttgtggatcgagtcctggcccaagt
ggagcttacatgccaatgagttcaggaacaggacactcgcattcacgaggatcttcactt
gtagaggagtcaaacactttaccagaaggttatgtacctatggcacccgttggaaataat
ggatacgttgacatggatccttcgcataatcacaatggtcattttcccgatgatctgtcg
catggtggcagtagttgttccgtcacttctggtacacctagcacagatttacgcttttcc
gagtatcatctagataaagtaacaagttttcttccacctggagacgatttgcaagcgaga
ccagcaagagcctattccattggttctcgaccagaacctataaaaagtcatcgtaagaat
agattggatattactcagcaagacgttagtagagtacgagcattctctgtaggtagcaga
tccaaaaaacctgaactcgggaaattagtgaatgtagttactgcaccattaccagttggt
tgtgaaaactcgagttccaataaatcgaactctgcaccgttattatcgagttcttggggt
cataattccggttgttctataacttctgaaagaatggaggatctaatggaattggacttt
acgaaacccagtatttctacaacctttaattcacccccttcatcttattcacaaccgcaa
tctcagtcacattcgttctctactgccactgacaccagttcctatgttgatatgtctcct
ggacaaccaccctcgtcgaccactgccccatacgtggatatgagccgcataaataagatt
aatcgtaataacaataataatacaatcactgccaatcaaaatcatagtcacattcatgta
tcgtcctctgcttccatacataaacccgtaattactacattgaagccggtggaagaagca
gaaggaccatacatgagaatggatggtataatggaggattggtcacaatccggtagtagc
cctaagttaatttcatcgcctatgcaagaagaaagtgtgcaatcgaatggaccgccagga
gccacgagaacagcaccggtcgatcttccacggcgtccacctgccgactatgttgatatg
aatttcaagccgagaacaagtttagaacaagattacataaatatgaacatgagcaatcga
aacaatcgtaaaccaatggcaacgcgaaccggtagtcgtaaagagaagtcacgttcgcag
ccaattgcgatccaagcgggaaacaaacctataaaaacgcctagtttcttacctttaaac
ggaagtccggaatcggaaagtttagcgagtacacccgcatctcctccccgagcaactccg
acaggttcctcggcgactattttccctttctccttgaacagtcctcaatcgcccgagaaa
tcatttacgcatcaaaagaataccgatgaactgaaaccatcagaactgaatatgaacctt
aaacataataacgatcgtactattgcagatgctacgaatggtagagttagcacgatcaat
tctatttctgtaacagatgcaaatagtagtactttgtcgaaagtaatgattaaagataga
gcatctagtcctacagggaaggataatcaagttaatcgcataatatcaaacaactcgttg
acctcgcaagataatacattgaacaatgtaacaaaaaagttttctgatttaaacgtatcg
aagccacgtttgatcactgcgtccccgaacaccagccccacgttatccggctttaagcca
actattgaaaaacaaccatcgtcccctaaattgccagatgaaacaccaacacctacacct
accgcgatgccaagtccattagaaaaagagaattttgataaagtgcaagctgctgcggaa
attttgcactatgctagtctagatcttcctgaagttggtaatgcggcacctatgtcgcca
gcatcccaagaaggcttcaattacgctaaaatcgatttcgctaaacttaagcaaaactaa

DBGET integrated database retrieval system