KEGG   Apis mellifera (honey bee): 408438Help
Entry
408438            CDS       T01057                                 

Gene name
IRS, GB11037, InRS, chico
Definition
insulin receptor substrate
Orthology
K16172  
insulin receptor substrate 1
Organism
ame  Apis mellifera (honey bee)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    408438 (IRS)
   04150 mTOR signaling pathway
    408438 (IRS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG13
AA seq 1219 aa AA seqDB search
MSSSRGLVSPSGGPVVLCGHVKKLKTQKKKYFVLRGEAPGYPACLEYYDSKKKFENRQPP
KRSILLDSCFNINRRVDTKHKHVIALYTKDECFCLILESEKELDEWLKAMLLLQSGDVAD
GEQPRPIFEHVWQVTMQKKGLGERKNIHGPYRLCLTDRTLSLVKIGAKDNSDSIEFPLIC
IRRCGYMDRIFYMEVGRSAVTGGGELWMEAEDNNIAHNMHAAIMNSMSNSSSSKDDVGPR
QRVRSSSATEASKPIFVLPHRYTGQRFYNSPLEEHRTHEEQVDPVQDQEQSNQTQSTSSC
NTITVVAGTGAGGTAGIASTNTNCATTARRRHSVASQPHSINNSQSVHVTTTSTTTTTTT
TITITMTATVTTTTTTATISHQRTLSLPLAAIINQMQSSKRSVLRCANGRDRCDSLPSRG
RTTSESHPTSIISHPRSSHFVSHVMRPHSMYVKGVSYSPPISSMPISPASGACSTDSAGS
SLSMDDGGENVLEEGTVSRYGHSLTPDEPVILEENGDDYAPWSTSHSHHKYSPNFKSHSP
SQQSSYLEMCSPCGSSPGPSGAYMPMSSGTGHSHSRGSSLVEESNTLPEGYVPMAPVGNN
GYVDMDPSHNHNGHFPDDLSHGGSSCSVTSGTPSTDLRFSEYHLDKVTSFLPPGDDLQAR
PARAYSIGSRPEPIKSHRKNRLDITQQDVSRVRAFSVGSRSKKPELGKLVNVVTAPLPVG
CENSSSNKSNSAPLLSSSWGHNSGCSITSERMEDLMELDFTKPSISTTFNSPPSSYSQPQ
SQSHSFSTATDTSSYVDMSPGQPPSSTTAPYVDMSRINKINRNNNNNTITANQNHSHIHV
SSSASIHKPVITTLKPVEEAEGPYMRMDGIMEDWSQSGSSPKLISSPMQEESVQSNGPPG
ATRTAPVDLPRRPPADYVDMNFKPRTSLEQDYINMNMSNRNNRKPMATRTGSRKEKSRSQ
PIAIQAGNKPIKTPSFLPLNGSPESESLASTPASPPRATPTGSSATIFPFSLNSPQSPEK
SFTHQKNTDELKPSELNMNLKHNNDRTIADATNGRVSTINSISVTDANSSTLSKVMIKDR
ASSPTGKDNQVNRIISNNSLTSQDNTLNNVTKKFSDLNVSKPRLITASPNTSPTLSGFKP
TIEKQPSSPKLPDETPTPTPTAMPSPLEKENFDKVQAAAEILHYASLDLPEVGNAAPMSP
ASQEGFNYAKIDFAKLKQN
NT seq 3660 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgagcaggggtttagtctccccttcaggaggtcccgttgttctctgcggtcac
gtgaagaaactaaagactcaaaagaaaaagtactttgtactgcgtggcgaagcaccagga
tatccagcatgtcttgaatattatgatagtaaaaagaaatttgaaaacagacaaccaccg
aaacgtagcattttattggacagttgctttaatattaatagacgcgtagatactaaacac
aaacatgttattgcattatatacgaaagatgaatgcttttgcttaattctggagagtgaa
aaagaactggatgaatggttaaaagcgatgcttttacttcagagcggagatgtagctgat
ggagagcaacctcggcctatatttgaacacgtatggcaagttacaatgcaaaaaaaggga
ttaggtgaacgaaagaatattcatggtccctatagactatgtttaactgatagaacatta
agcctagtaaaaattggagcaaaggataattcagattctatagaatttcctctaatttgc
atcagaagatgtggatatatggatcgtattttctatatggaagtaggtcgttcagcagtc
actggtggtggtgaattgtggatggaagctgaagacaacaatattgcacataatatgcat
gctgctattatgaattctatgagcaattctagtagcagtaaagatgatgtgggaccacgt
caaagagtgcgtagttcttctgctactgaagctagcaagccaatttttgtattaccacat
cgatatactggacaaagattctataattcaccattagaggaacacaggacgcacgaggag
caggtggacccagttcaagatcaagagcagtctaatcagactcagagtacctcttcttgc
aatacaatcacggtcgttgctggtaccggggctggtgggactgctgggattgcctcgact
aataccaactgtgccactaccgctagacgtcgtcattcggtagcgagtcaaccccattcc
atcaataattcccaatccgttcatgttacaacaacaagtacaactacaacaactaccact
actattaccatcactatgaccgctaccgtgaccaccacaaccacaaccgcgacaatatcc
catcagagaaccttgtcgctgcccttagctgccattatcaatcaaatgcaatcatctaaa
agatcagttttacgctgtgcaaatgggcgtgacagatgtgacagcttgccatcgaggggt
cgtactaccagcgaaagtcatccaacatcgataataagccatcctaggagttctcatttt
gtttctcatgtgatgagaccgcattctatgtacgtgaaaggcgtttcctattcaccgcca
atctcttcgatgcctattagtcctgcttccggtgcgtgttccacggattctgcaggatcc
tctctttcaatggatgatggtggtgaaaatgtgttggaagagggtactgtttcaagatat
ggacattctttgacgcctgacgaacctgttattctggaggaaaatggcgacgattatgct
ccgtggtccacatcacattcgcatcataaatattcaccaaattttaaatctcattctcct
tcccagcaaagttcctatttagaaatgtgtagtccttgtggatcgagtcctggcccaagt
ggagcttacatgccaatgagttcaggaacaggacactcgcattcacgaggatcttcactt
gtagaggagtcaaacactttaccagaaggttatgtacctatggcacccgttggaaataat
ggatacgttgacatggatccttcgcataatcacaatggtcattttcccgatgatctgtcg
catggtggcagtagttgttccgtcacttctggtacacctagcacagatttacgcttttcc
gagtatcatctagataaagtaacaagttttcttccacctggagacgatttgcaagcgaga
ccagcaagagcctattccattggttctcgaccagaacctataaaaagtcatcgtaagaat
agattggatattactcagcaagacgttagtagagtacgagcattctctgtaggtagcaga
tccaaaaaacctgaactcgggaaattagtgaatgtagttactgcaccattaccagttggt
tgtgaaaactcgagttccaataaatcgaactctgcaccgttattatcgagttcttggggt
cataattccggttgttctataacttctgaaagaatggaggatctaatggaattggacttt
acgaaacccagtatttctacaacctttaattcacccccttcatcttattcacaaccgcaa
tctcagtcacattcgttctctactgccactgacaccagttcctatgttgatatgtctcct
ggacaaccaccctcgtcgaccactgccccatacgtggatatgagccgcataaataagatt
aatcgtaataacaataataatacaatcactgccaatcaaaatcatagtcacattcatgta
tcgtcctctgcttccatacataaacccgtaattactacattgaagccggtggaagaagca
gaaggaccatacatgagaatggatggtataatggaggattggtcacaatccggtagtagc
cctaagttaatttcatcgcctatgcaagaagaaagtgtgcaatcgaatggaccgccagga
gccacgagaacagcaccggtcgatcttccacggcgtccacctgccgactatgttgatatg
aatttcaagccgagaacaagtttagaacaagattacataaatatgaacatgagcaatcga
aacaatcgtaaaccaatggcaacgcgaaccggtagtcgtaaagagaagtcacgttcgcag
ccaattgcgatccaagcgggaaacaaacctataaaaacgcctagtttcttacctttaaac
ggaagtccggaatcggaaagtttagcgagtacacccgcatctcctccccgagcaactccg
acaggttcctcggcgactattttccctttctccttgaacagtcctcaatcgcccgagaaa
tcatttacgcatcaaaagaataccgatgaactgaaaccatcagaactgaatatgaacctt
aaacataataacgatcgtactattgcagatgctacgaatggtagagttagcacgatcaat
tctatttctgtaacagatgcaaatagtagtactttgtcgaaagtaatgattaaagataga
gcatctagtcctacagggaaggataatcaagttaatcgcataatatcaaacaactcgttg
acctcgcaagataatacattgaacaatgtaacaaaaaagttttctgatttaaacgtatcg
aagccacgtttgatcactgcgtccccgaacaccagccccacgttatccggctttaagcca
actattgaaaaacaaccatcgtcccctaaattgccagatgaaacaccaacacctacacct
accgcgatgccaagtccattagaaaaagagaattttgataaagtgcaagctgctgcggaa
attttgcactatgctagtctagatcttcctgaagttggtaatgcggcacctatgtcgcca
gcatcccaagaaggcttcaattacgctaaaatcgatttcgctaaacttaagcaaaactaa

DBGET integrated database retrieval system