KEGG   Apis mellifera (honey bee): 408583Help
Entry
408583            CDS       T01057                                 

Gene name
GB17608
Definition
uncharacterized LOC408583
Orthology
K10373  
tropomyosin 1
Organism
ame  Apis mellifera (honey bee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 504 aa AA seqDB search
MEPALTSTTRRRGHQHHPRHATRRRLDASSRGPAQCGPADIVKDTAIRNNETSTTTTSPK
LDEKSNVIDTECSTAVTVPTIGTRWLRDPTATVSTKDVTSNEDSNKIKYNIEHDREENIR
HRLAQCSLDVIDERHEQFVRKRNENENFDSYKMEKVLDNSESKSCGNEICENESDEEKRN
NENSPEPEHAVARARGDGNSDDESTNVEEDPELAELAKLRCPSERTEVQAEREAKRRKRC
ADYPGLAFGWSIFSSDTMMKFGLIRNELQNIMGNQLKRAESEVAALNRRIQLLEEDLERS
EERLATATAKLAEASQAADESERIRKALENRTNMEDDRVSLLEQQLAQAKLIAEEADKKY
EEVARKLVMMEQDLERAEEKAELSEGKIVELEEELRVVGNNLKSLEVSEEKATQREETFV
GQVKILDSQLKEAEARAEFAERSVQKLQKEVDRLEGAYSSGIYIFVSRDYDQFFVLETFT
FSNGPLYFFISTNNVENYFIFLIL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagctctgacgtcgaccacgagacgtcgcggtcatcaacatcatccgcgacac
gctacgcgccgacgtctcgacgcctccagcagaggacccgcgcagtgtggccctgctgat
atcgttaaagatacggcgatcagaaacaatgaaacatcaacaactacaacgtcaccgaag
cttgatgaaaaaagcaatgtcatcgatacagaatgttccactgcggtgacagtgcccaca
atcggcacgaggtggcttcgtgatccgacggccacggtgtctacgaaagatgtaacatcg
aatgaagattcaaacaagataaaatataatattgagcatgatagagaagaaaacatccgt
cataggctcgcgcagtgtagcctggatgttattgacgaacgacacgaacaatttgttcgc
aaaagaaacgaaaatgagaactttgatagttataaaatggaaaaagtattggacaattct
gaatcaaaatcatgtggaaatgaaatatgcgaaaatgaatctgacgaagaaaagagaaac
aatgaaaattcgccagagcctgagcacgcggtcgcgagggctcgcggtgatggaaactct
gacgacgaatcaactaatgtcgaggaggatcctgaacttgctgaacttgccaaattgaga
tgtcctagcgaaagaaccgaggtacaagctgaaagagaagctaaaagaagaaaaagatgc
gctgattatcctggattagcctttggatggtctatattctccagcgacacaatgatgaaa
ttcggtctcataaggaacgaattgcagaatattatgggaaaccagctaaaacgggctgag
tccgaagtagccgctctgaatcgtcgtatccaattgttggaggaggatcttgagagatcg
gaggaacgccttgcaacggccactgctaaattggcagaggcgtcgcaagcagcggatgag
agcgaacggatacgcaaggcactcgaaaaccgtaccaatatggaagatgaccgggtatcc
ctgttggagcagcagctagcacaggctaaactgatcgccgaggaggcggataaaaaatac
gaggaggttgccagaaaactagtcatgatggaacaagatctcgagcgcgccgaggagaag
gcggaactttcagaagggaagatcgttgagctcgaggaggaattgcgcgtagttggcaac
aatctgaaatccctcgaggtctccgaagagaaggcgacacagagagaggagactttcgtg
ggccaggtgaagatattggatagtcaattgaaagaggctgaagctcgtgccgagttcgcg
gaaagatcggtgcagaagttgcagaaggaggtcgacaggctcgaaggtgcgtattcatca
ggcatttatattttcgtttcgcgtgattatgatcaatttttcgttctcgagacttttact
ttctcgaatggcccattatattttttcatctctacaaataacgtggagaattattttatt
ttcctgatactttag

DBGET integrated database retrieval system