KEGG   Apis mellifera (honey bee): 408583Help
Entry
408583            CDS       T01057                                 

Definition
(RefSeq) tropomyosin
  KO
K10373  
tropomyosin 1
Organism
ame  Apis mellifera (honey bee)
Brite
Cytoskeleton proteins [BR:ame04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     408583
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   408583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BEEBASE: 
Position
LG1
AA seq 483 aa AA seqDB search
MEPALTSTTRRRGHQHHPRHATRRRLDASSRGPAQCGPADIVKDTAIRNNETSTTTTSPK
LDEKSNVIDTECSTAVTVPTIGTRWLRDPTATVSTKDVTSNEDSNKIKYNIEHDREENIR
HRLAQCSLDVIDERHEQFVRKRNENENFDSYKMEKVLDNSESKSCGNEICENESDEEKRN
NENSPEPEHAVARARGDGNSDDESTNVEEDPELAELAKLRCPSERTEVQAEREAKRRKRC
ADYPGLAFGWSIFSSDTMMKFGLIRNELQNIMGNQLKRAESEVAALNRRIQLLEEDLERS
EERLATATAKLAEASQAADESERARKILENRSLADEERMDALENQLKEARFLAEEADKKY
DEVARKLAMVEADLERAEERAEAGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYK
NQIKTLTSRLKEAEARAEFAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDLTFTELI
EKN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagctctgacgtcgaccacgagacgtcgcggtcatcaacatcatccgcgacac
gctacgcgccgacgtctcgacgcctccagcagaggacccgcgcagtgtggccctgctgat
atcgttaaagatacggcgatcagaaacaatgaaacatcaacaactacaacgtcaccgaag
cttgatgaaaaaagcaatgtcatcgatacagaatgttccactgcggtgacagtgcccaca
atcggcacgaggtggcttcgtgatccgacggccacggtgtctacgaaagatgtaacatcg
aatgaagattcaaacaagataaaatataatattgagcatgatagagaagaaaacatccgt
cataggctcgcgcagtgtagcctggatgttattgacgaacgacacgaacaatttgttcgc
aaaagaaacgaaaatgagaactttgatagttataaaatggaaaaagtattggacaattct
gaatcaaaatcatgtggaaatgaaatatgcgaaaatgaatctgacgaagaaaagagaaac
aatgaaaattcgccagagcctgagcacgcggtcgcgagggctcgcggtgatggaaactct
gacgacgaatcaactaatgtcgaggaggatcctgaacttgctgaacttgccaaattgaga
tgtcctagcgaaagaaccgaggtacaagctgaaagagaagctaaaagaagaaaaagatgc
gctgattatcctggattagcctttggatggtctatattctccagcgacacaatgatgaaa
ttcggtctcataaggaacgaattgcagaatattatgggaaaccagctaaaacgggctgag
tccgaagtagccgctctgaatcgtcgtatccaattgttggaggaggatcttgagagatcg
gaggaacgccttgcaacggccactgctaaattggcagaggcgtcgcaagcagcggatgag
agcgaacgagcccgcaagattctcgagaatcgcagtttggccgatgaagagcgcatggat
gccctagaaaatcagctgaaggaggccaggttccttgctgaagaagctgacaagaaatac
gatgaggtcgcccgtaaattggccatggttgaggccgatctagaacgtgccgaggaacgt
gccgaagctggagagtcgaagatcgttgagctcgaggaggaattgcgcgtagttggcaac
aatctgaaatccctcgaggtctccgaagagaaggccaaccagcgtgaagaggagtacaag
aaccaaattaagactcttacctctcgcctaaaggaggctgaagctcgtgccgagttcgcg
gaaagatcggtgcagaagttgcagaaggaggtcgacaggctcgaagacgagctcgtacac
gagaaggaaaagtacaaatacatctgcgacgatctggacctcacctttaccgaattgatc
gagaagaattaa

DBGET integrated database retrieval system