KEGG   Apis mellifera (honey bee): 408619Help
Entry
408619            CDS       T01057                                 

Gene name
GB15093
Definition
ubiquitin carboxyl-terminal hydrolase 3-like
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     408619 (GB15093)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   408619 (GB15093)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 559 aa AA seqDB search
MECPHLAQSVQFGGNDVEANCTKDLPFVCAVCGTEKSTWLCLYCGAIHCGRYVAGHALQH
HEENTQHCVCIDCENLAVFCYMCDEYVINDTTSGQIEKIRRATFRKDEHKENEENWNTSP
STTPSSRRENSEDNDADALWKAEVVVRNLRPRTARKRLHSLDGTSGDNRPATKRRSSKIT
KEKKVVGLRNLGNTCFMNVVLQSFNNISHFCEYLTQMPCLEGIPFDEPPTHRGRIVTPGR
AKEFMSDALLAEELRKVLLGLNLGGSNGQAISPECLFLVIWKVVPRFRGYQQQDAHEFLT
YMLDRLHTELLQLLPRLGHEPLGLRGKQSIVTAVFGGTLLSVVHCMNCRTDSKTHEPFQD
LSLDIPDRLQRRTKEQEEVCSLTYSLTRFFKVEELADSELYFCDNCMGKQRSTKRFWIHR
LPNVLCLHIKRFRWCNSYRSKVDTQVDFPMKSLDMSAFTVRGVNGTKLGASNSHLYDLAA
VIVHHGSGYALTSFSMLILLCKVESNLFYILFILIFVITFLFLYIYTFSIFHINLLYTLN
IILQNIVFIYKKQNSMESV
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtccacatcttgctcaaagcgtccaattcggcggtaacgacgtagaagcgaat
tgtacgaaggatctaccattcgtctgtgcagtatgtggcaccgagaaaagtacgtggctc
tgtctgtactgtggagccattcactgtggacgatacgtggcaggccatgcattacagcat
cacgaagaaaatactcaacactgtgtttgtatcgactgtgagaacctggcagtattctgt
tacatgtgcgacgagtatgttatcaacgacacgacgagcggccaaatcgagaagatacgt
cgcgccaccttccgtaaagacgagcacaaagagaacgaagagaattggaacacttcgcca
tctacgacgccgtcctcgaggagggagaacagcgaagataacgacgcggacgctttatgg
aaggcagaagtggtcgtaaggaatctccggccgaggacagcgcgaaagaggttacattcg
ttggacggaacgagcggggacaataggccggcgacaaagcgtaggagctcgaagataacc
aaggagaagaaagtcgtcgggctgaggaatctcggcaacacctgtttcatgaacgtcgtg
ctacaatcgttcaacaatatcagccatttttgcgaatatctcacgcagatgccgtgtctc
gaaggtataccgttcgacgagccgcccacgcacagaggtcgaatcgtcacacccggtaga
gcaaaagaattcatgagcgacgccctgctcgcggaagagttgagaaaggttctgcttggc
ttgaatctaggcggttcgaatggccaggcgatatcccccgaatgccttttcctcgtcatc
tggaaagtcgtgccaagatttcggggctaccaacaacaagacgctcatgaatttctcacc
tacatgttggacagactacatacggaacttttgcaattgttgcccagactgggacacgaa
cctctcggtctgcgcggtaaacaaagcatcgtcacagctgtgtttggaggcactcttctt
agcgtggtccactgcatgaactgtcgtacggattccaagacgcacgagccctttcaggat
ctttcattggatataccggacagattgcagagacggacgaaagagcaagaagaggtttgc
agtctcacgtacagtttaacgagattcttcaaagttgaagagctggccgatagcgaacta
tacttttgtgacaattgcatggggaaacagagatccactaagaggttctggatacacagg
ctgcctaatgtgttgtgccttcacattaaaagatttaggtggtgcaattcctatcgctcg
aaggtggatacacaggtggattttccaatgaagtcacttgatatgtctgcatttacagtg
cgtggcgtgaatggaacaaaattgggcgcttcgaatagtcatctgtatgatttagctgct
gttattgtgcatcatggttctgggtatgctctaacctctttttccatgttaattcttcta
tgtaaagtagaatcaaacttattttacattttatttattctcatattcgttattaccttt
ttattcttgtatatttataccttttccatctttcatatcaacctattgtatacgttgaac
ataatattacaaaatattgtatttatttataagaagcaaaattcaatggaatcagtgtaa

DBGET integrated database retrieval system