KEGG   Apis mellifera (honey bee): 408619Help
Entry
408619            CDS       T01057                                 

Gene name
GB15093
Definition
ubiquitin carboxyl-terminal hydrolase 3-like
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
ame  Apis mellifera (honey bee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG1
AA seq 559 aa AA seqDB search
MECPHLAQSVQFGGNDVEANCTKDLPFVCAVCGTEKSTWLCLYCGAIHCGRYVAGHALQH
HEENTQHCVCIDCENLAVFCYMCDEYVINDTTSGQIEKIRRATFRKDEHKENEENWNTSP
STTPSSRRENSEDNDADALWKAEVVVRNLRPRTARKRLHSLDGTSGDNRPATKRRSSKIT
KEKKVVGLRNLGNTCFMNVVLQSFNNISHFCEYLTQMPCLEGIPFDEPPTHRGRIVTPGR
AKEFMSDALLAEELRKVLLGLNLGGSNGQAISPECLFLVIWKVVPRFRGYQQQDAHEFLT
YMLDRLHTELLQLLPRLGHEPLGLRGKQSIVTAVFGGTLLSVVHCMNCRTDSKTHEPFQD
LSLDIPDRLQRRTKEQEEVCSLTYSLTRFFKVEELADSELYFCDNCMGKQRSTKRFWIHR
LPNVLCLHIKRFRWCNSYRSKVDTQVDFPMKSLDMSAFTVRGVNGTKLGASNSHLYDLAA
VIVHHGSGYALTSFSMLILLCKVESNLFYILFILIFVITFLFLYIYTFSIFHINLLYTLN
IILQNIVFIYKKQNSMESV
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtccacatcttgctcaaagcgtccaattcggcggtaacgacgtagaagcgaat
tgtacgaaggatctaccattcgtctgtgcagtatgtggcaccgagaaaagtacgtggctc
tgtctgtactgtggagccattcactgtggacgatacgtggcaggccatgcattacagcat
cacgaagaaaatactcaacactgtgtttgtatcgactgtgagaacctggcagtattctgt
tacatgtgcgacgagtatgttatcaacgacacgacgagcggccaaatcgagaagatacgt
cgcgccaccttccgtaaagacgagcacaaagagaacgaagagaattggaacacttcgcca
tctacgacgccgtcctcgaggagggagaacagcgaagataacgacgcggacgctttatgg
aaggcagaagtggtcgtaaggaatctccggccgaggacagcgcgaaagaggttacattcg
ttggacggaacgagcggggacaataggccggcgacaaagcgtaggagctcgaagataacc
aaggagaagaaagtcgtcgggctgaggaatctcggcaacacctgtttcatgaacgtcgtg
ctacaatcgttcaacaatatcagccatttttgcgaatatctcacgcagatgccgtgtctc
gaaggtataccgttcgacgagccgcccacgcacagaggtcgaatcgtcacacccggtaga
gcaaaagaattcatgagcgacgccctgctcgcggaagagttgagaaaggttctgcttggc
ttgaatctaggcggttcgaatggccaggcgatatcccccgaatgccttttcctcgtcatc
tggaaagtcgtgccaagatttcggggctaccaacaacaagacgctcatgaatttctcacc
tacatgttggacagactacatacggaacttttgcaattgttgcccagactgggacacgaa
cctctcggtctgcgcggtaaacaaagcatcgtcacagctgtgtttggaggcactcttctt
agcgtggtccactgcatgaactgtcgtacggattccaagacgcacgagccctttcaggat
ctttcattggatataccggacagattgcagagacggacgaaagagcaagaagaggtttgc
agtctcacgtacagtttaacgagattcttcaaagttgaagagctggccgatagcgaacta
tacttttgtgacaattgcatggggaaacagagatccactaagaggttctggatacacagg
ctgcctaatgtgttgtgccttcacattaaaagatttaggtggtgcaattcctatcgctcg
aaggtggatacacaggtggattttccaatgaagtcacttgatatgtctgcatttacagtg
cgtggcgtgaatggaacaaaattgggcgcttcgaatagtcatctgtatgatttagctgct
gttattgtgcatcatggttctgggtatgctctaacctctttttccatgttaattcttcta
tgtaaagtagaatcaaacttattttacattttatttattctcatattcgttattaccttt
ttattcttgtatatttataccttttccatctttcatatcaacctattgtatacgttgaac
ataatattacaaaatattgtatttatttataagaagcaaaattcaatggaatcagtgtaa

DBGET integrated database retrieval system