KEGG   Apis mellifera (honey bee): 408785Help
Entry
408785            CDS       T01057                                 

Gene name
GB10882
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase-like
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ame  Apis mellifera (honey bee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG4
AA seq 295 aa AA seqDB search
MNTSKLPNIPRIPSDAISDTYIGTKNNTIPPQIPEKKRAIYKCTCSVAKIVNSQQPQSGK
PIKHPATLRPNLFAIIPTVKLVKAAVMHVTPISQDTSSSDIGLSPTGGFSLCSCGIIVWN
MAWHCSGTTNQEMVTKLKEAGILTTDRAEAAMLAVDRGNYYHESNPYLDQPRKIGYNVTI
SAPHMHAYALSILSDQLFDGAKALDVGSGSGYLTACMAFMVGSRGRVIGIDHIPELIEIS
TKNVSEDCPHFIQEERVKFVVGDGRLGYAADSPYNAIHVGAAAETLPQQFLLYSS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaatactagtaaactacccaacataccacgtattccgtcggatgcaatttcagacaca
tacattggcaccaagaacaataccatcccgccacaaattcccgaaaagaaacgtgcgata
tataaatgtacgtgttctgttgcaaaaatagtaaatagccaacagccgcaaagtggcaaa
cccatcaaacatccagccaccttgcgcccgaatctattcgctataataccgactgtcaaa
ctcgtgaaagcggctgttatgcacgtgactccaatcagccaggatacttcctcgtccgac
ataggcctatcacctaccggaggattttcactttgtagttgcggtattatagtgtggaac
atggcatggcattgcagtggaactacaaaccaagaaatggtaaccaaattaaaagaagca
ggtattctaacaacagacagagcagaagctgcgatgcttgctgtagatagaggaaactat
tatcatgaatcaaatccatatcttgatcaaccaagaaaaattggttacaatgttactatt
agtgcccctcacatgcacgcatatgctttgtctattctatctgaccaattgttcgatgga
gcaaaagcattggatgttggttctggatctggttacctgactgcatgtatggcattcatg
gttggttcacgtggtcgtgtaatcggaatcgatcatattccagaattaatagaaatttct
acgaaaaacgtaagcgaagattgtcctcatttcatccaggaagaacgcgttaaatttgta
gtgggagacggccgattgggatatgctgctgacagcccttacaatgcgattcacgttgga
gcagcagcggaaactctaccacaacagtttcttttatattccagttaa

DBGET integrated database retrieval system