KEGG   Apis mellifera (honey bee): 408788Help
Entry
408788            CDS       T01057                                 

Gene name
GB16747
Definition
glucuronosyltransferase
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ame  Apis mellifera (honey bee)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    408788 (GB16747)
   00053 Ascorbate and aldarate metabolism
    408788 (GB16747)
   00500 Starch and sucrose metabolism
    408788 (GB16747)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    408788 (GB16747)
   00860 Porphyrin and chlorophyll metabolism
    408788 (GB16747)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    408788 (GB16747)
   00982 Drug metabolism - cytochrome P450
    408788 (GB16747)
   00983 Drug metabolism - other enzymes
    408788 (GB16747)
Enzymes [BR:ame01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     408788 (GB16747)
Glycosyltransferases [BR:ame01003]
 Others
  Hydrophobic molecule
   408788 (GB16747)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG4
AA seq 544 aa AA seqDB search
MGINQTRAIFLFILAINLLSYSNANNPVSSENSRIKILAIFPHPGKSHFFVFKPFIEELA
RRGNELTVISYFPRTEKDEHLPTYKDISLANKESDVFLNVVNLNEFKRTSYIYEYFSNIF
MLSYMRSIACENLRNPGVKKLIENGEKFDLVLVENFNTHCFMSLVYKLNVPFIDISTHQP
MPWAIYNFRLSNDASFIPMSLTSILKPMNLFYRTINALSLYVSSGIYWTIFQWNDQAIVK
EIFGPDVPNVMTINKNVSVFFINTHYTIHGGASYPPNVIEVGGIHIESKRKPLPRNIAKF
LDEAHEGVLYFNLGSMIKMSTIPKDKLNILIKVFRSIPRKVIWKWEQDDIPELPGNVMIQ
KWLPQYDILNHPNVKCYFGHGGLLGLTEGVQSGVPMILMPIFGDQYSNAAAAQYRGVAII
LEYNDFTEEKLRSAMDQIFNDTRYGENAKRLSKAFKDRMTSPLETAIWWTEYVARGNGLP
YVKSEAITMPWYERHLIDVHAIFVLFSLLALYVQYRIVKYAFAYVLRSEDAGSKKRANLS
KKRD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgggaattaatcaaactcgagccatctttttgtttatcctcgcgataaatttattatcg
tattcaaatgctaataatcctgtctcgtctgaaaatagccgcataaaaattctggcaatc
tttcctcatccgggtaagagccatttcttcgtgttcaaacctttcatcgaagagttagca
cgtcgaggcaatgaattgacggtgatttcttattttccgagaaccgagaaggatgaacat
cttcccacttacaaggatatcagtttggccaataaagagagtgacgtgtttttaaacgta
gtcaatttgaacgaatttaaacggacgtcttacatttatgaatatttcagcaatatattc
atgttgtcctacatgagatccatagcttgtgaaaatttgagaaatccaggtgtaaagaaa
ctgatcgaaaatggggaaaaattcgacctggtactggtagagaatttcaacactcattgt
ttcatgagccttgtgtataaattgaacgtacccttcatagatatatctactcatcagcca
atgccatgggctatatataattttagactttccaacgatgccagtttcatacctatgtcg
ttgacttcgattttaaaaccgatgaatcttttttatagaacgataaacgcgttgtcgcta
tacgtttcatcggggatatattggacgattttccagtggaacgatcaggctatagtgaaa
gaaattttcggcccggatgtaccgaatgtgatgacgataaacaagaacgtatccgttttt
ttcattaacacgcattacactattcacggtggagcctcttatccgccgaatgtcatcgaa
gtgggcggaattcacatcgaatcgaagagaaaaccattgccccgaaacatagccaaattt
ctggacgaggctcacgagggtgttttgtatttcaatctcggttcgatgatcaaaatgtct
acgataccgaaggataaattgaacatattgatcaaagtgtttcgttccattcctagaaaa
gtgatttggaaatgggagcaggatgacattccggaattacctggcaacgtcatgatccag
aaatggctgcctcagtacgatatattaaatcatccgaacgtcaagtgttacttcggccac
ggtggccttctcgggttaacggaaggggttcagagcggggtcccgatgatactgatgccc
atcttcggtgatcaatattcgaacgcggccgcggctcaatacagaggcgtcgctattatc
ctggaatacaacgatttcaccgaggaaaagctgagaagcgccatggaccaaatattcaat
gacacgaggtatggagagaacgccaagaggctttcgaaagcttttaaagatcggatgacc
agccctctggagacggcgatatggtggacggagtacgtggcacgtgggaacggtttgcca
tacgtgaagagcgaggcgataaccatgccttggtacgaacgtcacctcatcgatgtgcac
gccatcttcgtactcttctctttgctcgccctttacgtccaatacaggatagtaaagtac
gcgtttgcctacgttctgagatcggaggacgcgggtagtaaaaagcgagcgaatctctcg
aagaagagggattga

DBGET integrated database retrieval system