KEGG   Apis mellifera (honey bee): 408791Help
Entry
408791            CDS       T01057                                 

Gene name
Plc, GB16555
Definition
phospholipase C
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ame  Apis mellifera (honey bee)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    408791 (Plc)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    408791 (Plc)
   04070 Phosphatidylinositol signaling system
    408791 (Plc)
 Organismal Systems
  Sensory system
   04745 Phototransduction - fly
    408791 (Plc)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     408791 (Plc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG4
AA seq 1253 aa AA seqDB search
MASNKTAGSVVQFRPIEVSQQLQEGEKFIKWDEDSGIATPVTLRVDKFGFYLHWVDQHNE
MEMLDIAVIRDTRTGKYAKVPKDPKLRYLVTMGSQDSLEEKTVTICYGSDFVNMNFINFC
TTRAEVAKHWTEEIFQLAYNLSLLNISTTMFLQKAHTKLTLAADKSGKIPVKNIIRMFTQ
NKEDRKRVEKALDISGFPSGKNDVISLQKFQFEDFFNFYKSLTQRSDVEKVFERIVGNNK
RRLMSVTQFVDFLNKTQRDPRLNEILYPYANEARAKDIISQYEPNKYNANRGQLSFDGFL
RYLMSEDNPIVALSKLELSDDMDQPLAHYFINSSHNTYLTGHQLTGKSSVEIYRQCLLAG
CRCVELDFWNGKFEEPVIVHGYTFVPEIYARDVIEAIAESAFKTSEYPVILSFENHCNPR
QQAKIAQYCRELFGEMLLDAPLESHKLEPGQELPPPCLLKRKIIIKNKKKHHHHHKKHKK
KQQTPVTEFEEEARENEDNGVTNQVAEGENGPPPDIVSHAEAIDNNDQQIGNGDISHPPM
LQQRQSSKDSTQDDEDEEEESTTEEDESNVEDIKLRMVDKVPAPDKVAPNAKETEAGAEI
SALVNYVQPVHFNSFESAEKKNRMYEMSSFDEKQATTLLKERPLEFVNYNKHQLSRVYPA
GTRFDSSNFMPQVFWNAGCQLVALNYQTLDLAMQLNLGIFEYNQRCGYLLKPEFMRRKDQ
RLDPFAESTVDGIIAGTVHIHVISAQFLTDKRVGTYIEVDMYGLPADTVRKKFRTKIVPN
NGINPVYDEEPFIFKKVVLPELASIRIAAYEESGRLIGHRVLPVVGLCPGYRHVALRTEC
GQPLPLANLFLHVIVKDYVPDGLSELAEALANPIKYQSETEKREKQLSVLTDGSEDPSEE
INEETVKTKRLQSVGELPPLVPPSTNIHGRPSIAGINMSETQDNEDGTPTSTVQVVDAST
NKSSVNITGMSDEIVAESLEKLMENKLVREKKIELEKKLESLRKKHEKEKLRMQTQKGSI
DGEKHKSKFYVSHKLVKRLSSRNIFSSEVGLSTLALAETSECTDIENREGNGGTPKGLPR
SQSERLLAVCKAHVQQERELQEKYYENLFATLEKVMKTSQSNQLKTLRVLLERETADVMR
KLQATRHGEVKQLAKVHKDKAELDRMKREVAKSTVEKGVNECTRLTKIYEKKRAELERQH
EEVRQRLEAERAKVKATLMAEYSSRCSKYESGELSLSPSGGTGMPESLSGNTY
NT seq 3762 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtaataagacagcaggtagtgtcgtgcaatttagacctattgaagtgtctcaa
caattacaagagggagaaaaattcatcaaatgggatgaggattctggtatagcaactcca
gtaacattgagagttgataaatttggattttacctgcattgggtggatcaacataatgaa
atggaaatgttggatattgctgtaataagagatactagaactggaaaatatgctaaagta
ccaaaggatcccaaattaagatatcttgtaacaatgggttctcaagattctttagaagag
aaaacagtaacaatttgttatggatctgattttgtcaatatgaattttattaacttctgt
acaacacgtgcagaagttgcaaaacattggacagaagaaatttttcaacttgcatataat
ctatccctattaaacatcagtacaactatgtttttgcaaaaagcacataccaaacttaca
cttgcagctgataaatcaggaaaaatacctgttaagaatattataagaatgtttacgcaa
aacaaagaagatcgtaaacgagtcgaaaaagctcttgatatttctggttttccatctgga
aaaaatgacgtaatatcattacaaaaatttcaatttgaagattttttcaacttttataaa
tctcttactcaacgatcggatgttgaaaaagttttcgaacgcatcgtaggcaataataag
cgtaggctaatgtctgtaactcaatttgttgactttttgaataaaactcaaagagatccg
cgtttaaacgaaatattgtatccttatgcaaatgaggcgagagcgaaggatattataagt
caatacgaaccaaataaatataatgcaaatcggggtcagctaagttttgatggatttttg
agatatttgatgagtgaagataacccaatcgtggctttatcgaaacttgaattatcagat
gacatggaccaaccgcttgcacattactttataaattctagtcacaatacatacttaaca
ggacatcaacttactggaaaaagttccgtcgaaatatatcgtcaatgtctgcttgctggt
tgccgatgtgtagaattggacttttggaatggaaaatttgaagaacctgtcattgttcat
ggatatacatttgtacctgaaatatatgcacgagatgtgattgaagcgattgctgaaagt
gcttttaaaacatcagaatatcctgttattcttagttttgaaaatcattgcaatccaaga
cagcaagctaagatagctcaatattgtagagaattatttggagaaatgttgctggatgct
cctcttgaatctcataagttggaaccaggacaagaattaccacctccatgtttattaaaa
cgcaagattataattaaaaataaaaagaaacatcatcatcatcataaaaaacataaaaaa
aagcaacagacaccggtaacagaatttgaagaggaagcgcgagaaaatgaagataatgga
gtaacaaatcaagttgcggagggagaaaatggaccgccgccagatattgtttctcatgct
gaagcaattgataataatgatcaacagatcggaaatggagatatttcacatcctccgatg
ttacagcaaagacaaagcagcaaggatagtactcaggatgatgaagatgaagaagaagaa
tctactacagaagaagatgaatcaaatgtagaggatattaaattaagaatggttgataaa
gtgcctgcacctgataaagtagcacctaatgccaaagaaacagaagctggagcagaaatt
tcagctttagttaattatgtgcaacctgttcattttaatagtttcgaatcagctgaaaaa
aaaaatcgaatgtatgaaatgtcatcatttgatgaaaaacaagctacaacacttttaaaa
gaaagaccattagaatttgtaaattataacaaacatcaattatcaagagtatatccagca
ggtacacgtttcgattctagcaatttcatgcctcaagtcttttggaatgcaggttgtcag
ctagttgcattaaattatcaaactcttgatcttgcgatgcaattaaatttgggaattttt
gaatataatcaacgttgtggttatctcttgaaaccagaattcatgagacgaaaggatcaa
cgattagatccttttgcggaatcgacagtagatggtattatagcgggaacggttcatata
cacgtaatatcggctcaatttttaacagacaaaagagtgggtacttatatagaagtagat
atgtatggtttacctgcagatacagtgagaaaaaaatttcgtacaaaaattgttccgaac
aatggaatcaatcctgtttacgatgaagaacctttcatatttaaaaaagtagttttgcct
gagcttgcttcaattagaattgctgcatatgaagaatcaggacgtttaattggtcataga
gtgctacctgtagttggattatgtccaggttaccgacatgttgctcttagaacagaatgt
ggacaaccattaccattagcaaatttatttttacacgtaattgtaaaagattatgtccca
gatggattgagtgaacttgctgaagctttagcaaatccaattaaatatcaaagtgaaaca
gaaaaaagagaaaaacagttatcagttcttacagacggttcagaagatccatcagaggaa
attaatgaggaaacagtcaaaacgaaaagattacaatctgtgggtgaattaccaccactt
gtaccaccatctacaaatattcatggtaggccatctattgctgggataaatatgtctgaa
acacaagataacgaggatggaactcctacatctacagttcaagttgttgatgcttccaca
aataaaagttcagtcaatatcactggtatgagcgatgaaatagtggccgaatctttagaa
aaattaatggaaaataaacttgttcgagaaaagaaaatagagctcgagaagaagcttgaa
tcattgcgaaaaaagcatgaaaaagaaaaattaagaatgcaaacgcagaaaggatccatc
gatggtgaaaagcataaatcgaaattctatgtgagccataaattagtgaaacgattgtca
agtagaaatatattttcaagtgaagtaggattgagtacgttagctttagcagaaacatca
gaatgcacagacattgaaaaccgcgaaggaaatggtggaactccaaaaggactacctaga
agtcagagtgaacgtttgttagccgtatgtaaagctcatgtacaacaagaacgagaactt
caggaaaagtactatgaaaatttatttgcaactttggagaaagtaatgaaaacttctcaa
tccaatcaattaaaaacattgagagtacttttagagcgagaaactgccgatgttatgaga
aaacttcaagctacaagacacggagaagtgaaacaattagcaaaagtgcataaagataaa
gccgaattagatcgtatgaagagggaggttgcaaaatcaacggttgaaaaaggcgtaaat
gaatgtacacgattaacaaaaatttacgagaaaaaaagagcagaactcgaacgacaacat
gaagaagttcgacaaaggttagaagcagaaagagcaaaggttaaagctactctaatggca
gaatatagtagtcgatgtagtaaatatgagagtggagagttatctttgtcgccatccggc
ggaactggtatgccggaatcacttagtggaaatacatattga

DBGET integrated database retrieval system