KEGG   Apis mellifera (honey bee): 408793Help
Entry
408793            CDS       T01057                                 

Gene name
chm
Definition
(RefSeq) histone acetyltransferase KAT7
  KO
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     408793 (chm)
Chromosome [BR:ame03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    408793 (chm)
   HAT complexes
    HBO1 complex
     408793 (chm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
LG4
AA seq 910 aa AA seqDB search
MTPKWKTTSSESTTTTSSGSSSSSSSSSGSESSSSDSENSSSSANSQKISDTERTKKKTT
FPPNRHGKSKVDTVAAPSVENKNKDRVPPKNRSVVYSSESEGSPSKVKGTTKRKPPTKPK
ATATVAPVVKQQRLPAKSVATTGQQKNVPNPKTIANKPNKPCASTSTNGKGPEKSIKTIS
EPVQKKLKKKSIFSPENSSESDSGIPTKANSVKPINSSTKYTKNQQSKPKPNDAKQKAVA
PNRSSLLTKSAQSQKSDSSASSKSCSAGSGSSASTDSSTDSESSESVTSPQPQTKKKDTQ
PSTTISATTNVPPKRPSAAVAPVKPQKCTKRQNTIKSEDEADASASEKEMDEPGETGTSK
ASIKGKRKLQTRKGSKLLQLQAKAASDSESDTGTETVACKRILQIPLIRCDLSRVAESKR
STSKSPVKRAGPSTAARHSSAANRIPQNSGTSNATTGRSGQGNYGRTRVNKERECPLAPT
CDSRGHLSGKLDSHFTLEACPLYHNTTPQACAEFYKERKKREEDRKKAIACLAKKSPKGL
HQTTEQRNYQLKVREMRNKWKGNTGDGNESDSSCELQGNEKDRQPRLTNLTPDYDLKLFM
EAQAIASEKIEKELKELDYDGEGRNSGGTRVIEMGKWEMEVWYQSPYPEEFSRAPKLYLC
EYCLRYAKSRQVLRRHREKCLWRHPPGHEVYRKDKIGVWEVDGKRYKQYCQNLCLLAKFF
LDHKTLYYDVEPFLFYVMTIGDSEGCHTVGYFSKEKNSFLNYNVSCILTLPPYQRQGYGR
LLIDFSYLLTRVEKKIGSPEKPLSDLGLISYRSYWKDVLLQYLCNFGGKELSVKDISKEM
AIDSYDIVSTLQALGMMKYWKGKHIILKKQDVIDDYKERVKRRGPVYKEIDPECLKWNPF
QPPKTPSASN
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgactccaaaatggaagaccactagttcagaatctaccacaacaactagttctggttct
tcatcaagtagttcttcaagttcaggcagtgaatctagttcatctgattctgaaaattct
agcagttctgctaatagtcaaaaaatatctgatacagaaagaacaaaaaagaaaacaaca
ttcccacctaatagacatggcaaatctaaagttgatacagttgctgctccttctgtagaa
aataaaaacaaagatagagtaccaccaaagaatagatccgtggtatattcttcagaatca
gaaggatcaccaagtaaagtaaaaggaacaacaaaaagaaagccacctactaaaccaaaa
gcaactgctacagtagcacctgttgttaaacaacaaaggctacctgctaaatcagtggct
actactggtcaacaaaaaaatgtaccaaatccgaaaacaattgctaacaaaccaaataaa
ccttgtgcctctacaagtactaatggaaaaggtcctgagaaatctataaaaacgatttct
gaacctgtacaaaaaaagttaaaaaagaagagtatattcagtcctgagaatagtagtgaa
agtgacagtggtattccaacaaaagctaattcggtaaagcctataaatagttctacaaaa
tacacaaaaaatcaacaatctaaaccaaaaccaaatgatgcaaaacagaaagcagttgct
ccaaatagatctagtttattaactaaatctgcacaatcacaaaaatcagatagttctgca
agttcgaaaagctgttctgcaggatcgggttcttcagcttccacagatagtagcacagat
tctgaatcatcagaaagtgttacaagtccacaaccacaaacaaagaaaaaagatactcaa
ccaagtacaacaataagtgccactacaaacgttccaccaaagcgaccatccgcagcagtt
gcacctgtaaaaccacaaaagtgtacaaaaagacaaaatacaataaaaagcgaagatgaa
gccgatgcatccgcgagtgagaaagaaatggatgaacctggtgaaacgggcacgtcgaaa
gcaagtatcaaaggcaaacgaaaactgcagactcgaaaaggtagcaaattgcttcaacta
caagcaaaggcagccagcgattcggaatctgatacaggtacggaaacggtagcgtgtaaa
cgtatcctgcaaattccgctgatccggtgtgatttatcgagagtagctgagagcaagagg
agtaccagcaaatcgcccgttaaacgtgctggacctagtactgcagccagacattcgtcc
gcagccaacagaataccacagaacagtggtacatcaaatgctactactggaagatcagga
caaggcaattatggccgcacacgcgtaaacaaggagagagaatgtcccctagcaccaaca
tgcgattctcggggccatctctctggaaaactcgattcgcatttcactttagaagcttgt
cctttgtatcacaacactacgccacaagcttgcgcggaattttataaagagaggaaaaaa
cgcgaagaagataggaaaaaagcgatagcatgcttggcgaaaaaatctccaaaaggcttg
caccaaacaacggaacagcgcaattatcaattaaaagtgagagaaatgagaaataaatgg
aaaggaaacaccggcgatgggaacgaaagcgatagtagttgtgaacttcagggaaacgag
aaagatcgtcagccacgattaacaaatttaacgccagactacgatttaaaattatttatg
gaagcgcaagcgatcgcaagcgaaaaaatcgagaaagaattaaaagaattagattacgac
ggtgaaggcagaaatagtggtggtacacgagttatcgaaatgggaaagtgggaaatggaa
gtatggtatcaaagtccatacccggaggaatttagtcgtgctccaaaactttatttatgc
gaatactgtttacgatatgcgaaaagtcgtcaagttctaagaaggcatcgagaaaaatgt
ttatggagacatccgcctggtcacgaagtgtatagaaaagataaaataggtgtctgggaa
gtcgacgggaaacgttacaagcaatattgtcaaaatctctgtttattggcaaaattcttt
ttggatcataagacattgtattacgatgtcgagcctttccttttttacgtgatgacaatt
ggcgattctgaaggttgtcacacggtcggatactttagtaaggagaaaaactcattcctg
aattacaacgtgtcctgcatactgaccctgccaccttatcaacgccagggatacggcagg
ctgctgatcgacttcagttacttattgaccagagtggagaaaaagattggctcccccgaa
aaacctctgtcggatctgggcttgatctcgtaccgcagctactggaaggacgttttgctg
cagtacctctgcaacttcgggggcaaggaactctccgtcaaagatatcagcaaggagatg
gccatcgattcgtacgatatcgtgagcactctacaggccctcggtatgatgaagtattgg
aaggggaagcacatcattctaaagaaacaggacgtgatcgacgactacaaggagagggtg
aagagacgaggacccgtctacaaagagatcgatccggagtgtctgaaatggaaccccttc
cagcctcccaagacgccctccgcctcgaactaa

DBGET integrated database retrieval system