KEGG   Apis mellifera (honey bee): 408793Help
Entry
408793            CDS       T01057                                 

Gene name
chm, GB13407
Definition
chameau
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
ame  Apis mellifera (honey bee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG4
AA seq 1028 aa AA seqDB search
MTPKWKTTSSESTTTTSSGSSSSSSSSSGSESSSSDSENSSSSANSQKISDTERTKKKTT
FPPNRHGKSKVDTVAAPSVENKNKDRVPPKNRSVVYSSESEGSPSKVKGTTKRKPPTKPK
ATATVAPVVKQQRLPAKSVATTGQQKNVPNPKTIANKPNKPCASTSTNGKGPEKSIKTIS
EPVQKKLKKKSIFSPENSSESDSGIPTKANSVKPINSSTKYTKNQQSKPKPNDAKQKAVA
PNRSSLLTKSAQSQKSDSSASSKSCSAGSGSSASTDSSTDSESSESVTSPQPQTKKKDTQ
PSTTISATTNVPPKRPSAAVAPVKPQKCTKRQNTIKSEDEADASASEKEMDEPGETGTSK
ASIKGKRKLQTRKGSKLLQLQAKAASDSESDTEAGREFSAGGGFRTLCCLLNTKKQYLRF
WMDGLDIYMARRNPLVDGTNISYTKKHVQGVLRCRYSLFAYAAVWFSGTETVACKRILQI
PLIRCDLSRVAESKRSTSKSPVKRAGPSTAARHSSAANRIPQNSGTSNATTGRSGQGNYG
RTRVNKERECPLAPTCDSRGHLSGKLDSHFTLEACPLYHNTTPQACAEFYKERKKREEDR
KKAIACLAKKSPKGLHQTTEQRNYQLKVREMRNKWKGNTGDGNESDSSCELQGNEKDRQP
RLTNLTPDYDLKLFMEAQAIASEKIEKELKELDYDGEGRNSGGTRVIEMGKWEMEVWYQS
PYPEEFSRAPKLYLCEYCLRYAKSRQVLRRHREKCLWRHPPGHEVYRKDKIGVWEVDGKR
YKQYCQNLCLLAKFFLDHKTLYYDVEPFLFYVMTIGDSEGCHTVGYFSKEKNSFLNYNVS
CILTLTTAVSYERLRWRKVARLESPLRESGAGRACTPRSVALIIKRGLFAVTSFSLMPRS
RGSGYLLTRVEKKIGSPEKPLSDLGLISYRSYWKDVLLQYLCNFGGKELSVKDISKEMAI
DSYDIVSTLQALGMMKYWKGKHIILKKQDVIDDYKERVKRRGPVYKEIDPECLKWNPFQP
PKTPSASN
NT seq 3087 nt NT seq  +upstreamnt  +downstreamnt
atgactccaaaatggaagaccactagttcagaatctaccacaacaactagttctggttct
tcatcaagtagttcttcaagttcaggcagtgaatctagttcatctgattctgaaaattct
agcagttctgctaatagtcaaaaaatatctgatacagaaagaacaaaaaagaaaacaaca
ttcccacctaatagacatggcaaatctaaagttgatacagttgctgctccttctgtagaa
aataaaaacaaagatagagtaccaccaaagaatagatccgtggtatattcttcagaatca
gaaggatcaccaagtaaagtaaaaggaacaacaaaaagaaagccacctactaaaccaaaa
gcaactgctacagtagcacctgttgttaaacaacaaaggctacctgctaaatcagtggct
actactggtcaacaaaaaaatgtaccaaatccgaaaacaattgctaacaaaccaaataaa
ccttgtgcctctacaagtactaatggaaaaggtcctgagaaatctataaaaacgatttct
gaacctgtacaaaaaaagttaaaaaagaagagtatattcagtcctgagaatagtagtgaa
agtgacagtggtattccaacaaaagctaattcggtaaagcctataaatagttctacaaaa
tacacaaaaaatcaacaatctaaaccaaaaccaaatgatgcaaaacagaaagcagttgct
ccaaatagatctagtttattaactaaatctgcacaatcacaaaaatcagatagttctgca
agttcgaaaagctgttctgcaggatcgggttcttcagcttccacagatagtagcacagat
tctgaatcatcagaaagtgttacaagtccacaaccacaaacaaagaaaaaagatactcaa
ccaagtacaacaataagtgccactacaaacgttccaccaaagcgaccatccgcagcagtt
gcacctgtaaaaccacaaaagtgtacaaaaagacaaaatacaataaaaagcgaagatgaa
gccgatgcatccgcgagtgagaaagaaatggatgaacctggtgaaacgggcacgtcgaaa
gcaagtatcaaaggcaaacgaaaactgcagactcgaaaaggtagcaaattgcttcaacta
caagcaaaggcagccagcgattcggaatctgatacagaggcgggtagagaattttctgca
ggcggtggatttaggactctatgctgcctccttaacacaaaaaagcagtatttgcggttc
tggatggatggattggacatatatatggcccgtaggaatccactggtcgatgggacaaac
atttcgtatacaaaaaagcatgtccaaggtgtcctaagatgcagatacagtctttttgct
tacgcggcagtatggttctcaggtacggaaacggtagcgtgtaaacgtatcctgcaaatt
ccgctgatccggtgtgatttatcgagagtagctgagagcaagaggagtaccagcaaatcg
cccgttaaacgtgctggacctagtactgcagccagacattcgtccgcagccaacagaata
ccacagaacagtggtacatcaaatgctactactggaagatcaggacaaggcaattatggc
cgcacacgcgtaaacaaggagagagaatgtcccctagcaccaacatgcgattctcggggc
catctctctggaaaactcgattcgcatttcactttagaagcttgtcctttgtatcacaac
actacgccacaagcttgcgcggaattttataaagagaggaaaaaacgcgaagaagatagg
aaaaaagcgatagcatgcttggcgaaaaaatctccaaaaggcttgcaccaaacaacggaa
cagcgcaattatcaattaaaagtgagagaaatgagaaataaatggaaaggaaacaccggc
gatgggaacgaaagcgatagtagttgtgaacttcagggaaacgagaaagatcgtcagcca
cgattaacaaatttaacgccagactacgatttaaaattatttatggaagcgcaagcgatc
gcaagcgaaaaaatcgagaaagaattaaaagaattagattacgacggtgaaggcagaaat
agtggtggtacacgagttatcgaaatgggaaagtgggaaatggaagtatggtatcaaagt
ccatacccggaggaatttagtcgtgctccaaaactttatttatgcgaatactgtttacga
tatgcgaaaagtcgtcaagttctaagaaggcatcgagaaaaatgtttatggagacatccg
cctggtcacgaagtgtatagaaaagataaaataggtgtctgggaagtcgacgggaaacgt
tacaagcaatattgtcaaaatctctgtttattggcaaaattctttttggatcataagaca
ttgtattacgatgtcgagcctttccttttttacgtgatgacaattggcgattctgaaggt
tgtcacacggtcggatactttagtaaggagaaaaactcattcctgaattacaacgtgtcc
tgcatactgacccttacaacggcggtgagttacgagcgtctccgttggcgtaaagtcgct
cgactcgaaagccctctccgggagtccggagcgggccgggcgtgtacaccgcggagcgta
gcgttgataattaaacgtgggctttttgccgtgacgtcattttcattgatgccgaggagt
cgaggcagcggttacttattgaccagagtggagaaaaagattggctcccccgaaaaacct
ctgtcggatctgggcttgatctcgtaccgcagctactggaaggacgttttgctgcagtac
ctctgcaacttcgggggcaaggaactctccgtcaaagatatcagcaaggagatggccatc
gattcgtacgatatcgtgagcactctacaggccctcggtatgatgaagtattggaagggg
aagcacatcattctaaagaaacaggacgtgatcgacgactacaaggagagggtgaagaga
cgaggacccgtctacaaagagatcgatccggagtgtctgaaatggaaccccttccagcct
cccaagacgccctccgcctcgaactaa

DBGET integrated database retrieval system