KEGG   Apis mellifera (honey bee): 408835Help
Entry
408835            CDS       T01057                                 

Gene name
amon, GB15843
Definition
amontillado
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     408835 (amon)
Peptidases [BR:ame01002]
 Serine Peptidases
  Family S8: subtilisin family
   408835 (amon)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG5
AA seq 723 aa AA seqDB search
MGRARVIYIVAHNSASLYVDSHDYTTTPTDFFTSEMNVVGNATSVVTTTEKKTSVSSFVE
VVDSSKIVVPSRTPNTVPANAKYISVRRRPVTMLLAVIALLCAGSSAEVFTNTFLVKMRQ
PAERHIADRVAARNGFVNLGPILGSQTEYHFVHKALPHARSKRSVPHMRRLKVDPLVHTA
VQQPGFKRVKRGYKPLSVDNLVPLYQIKNPSNPGNRDPSDPYFQYQWYLKNTGQNGGKPK
LDLNVKAAWAQGVTGKNVTTAIMDDGVDYMHPDLKYNYNTKASYDFSSNDPYPYPRYTDD
WFNSHGTRCAGEVAAARDNGVCGVGVAYDSKVAGIRMLDQPYMTDLIEANSMGHEPDLID
IYSASWGPTDDGKTVDGPRNATMRAIVRGVNEGRRGLGNIYVWASGDGGEEDDCNCDGYA
ASMWTVSINSAINDGQNAHYDESCSSTLASTFSNGAKDPNIGVATTDLYGKCTTTHSGTS
AAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKGRFHWTMNGVGLEFNHLF
GYGVLDAGAMVALAKKWKTVPPRYHCEAGSVLETQEVTSDRSILLKIKTDACAGTEYAVN
YLEHVQAVISVNATRRGDLELFLTSPMGTRSMILSRRINDDDHRDGFTKWPFMTTHTWGE
YPQGNWLLEVSFNTQTPQHGWIREWTLMLHGTREPPYTGLPAADPHSKLAIVKKAHEERS
SAM
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggggagagcacgtgtcatttatattgttgcgcacaactcggcaagcttatacgtcgac
tcgcacgattataccaccacccctaccgactttttcaccagtgaaatgaacgtagtcggt
aacgccactagcgttgtaacaaccaccgagaaaaagacatcagtttcttcttttgtagag
gtggttgatagttcgaaaattgtagtaccatcgcgtacaccgaatacagtgcccgcgaat
gctaagtacatcagcgtacgccgtcggcctgttacgatgctactcgcggtgatcgcgctc
ctctgtgccggtagcagtgccgaggtgttcactaacacgttcctcgtgaagatgaggcag
cccgcggaaagacacatcgctgatcgcgtggctgctagaaatggattcgttaatcttgga
ccgatattgggcagtcagacggaatatcacttcgtgcacaaagctctgccgcacgcacgg
agcaagagatccgtgccccacatgagaagattgaaggtggatcctttggtgcacacagcc
gtgcagcagcctggattcaagagagtgaagaggggttacaagcctcttagcgtggataat
ctggtgcccctctatcaaattaaaaatccatcgaatcctggcaacagagacccgtccgat
ccttactttcagtatcaatggtacttgaaaaacaccggccaaaatggcgggaaaccgaag
ctggacttgaacgtgaaagcagcctgggctcaaggtgtgaccgggaaaaatgtgaccaca
gctataatggacgatggggtcgattacatgcatccggatttgaaatataattacaacacg
aaagcctcttacgacttcagcagcaacgacccttacccttatccgagatacaccgatgat
tggttcaatagccacggaacgagatgcgccggcgaggtagcggcggcccgggacaacggc
gtgtgcggcgtgggcgtagcttacgactcgaaggtagccgggatccgaatgttggatcag
ccttacatgaccgacctgatcgaggccaacagcatgggccacgaacctgacctcatagac
atttatagcgcctcatgggggccgaccgacgacgggaaaaccgtggacgggccgcgaaat
gcgaccatgagggccatcgtgcgcggcgttaacgagggtcgaagaggattgggcaacatt
tacgtgtgggcctctggcgacggtggtgaggaggacgattgcaattgcgacggttacgcg
gccagtatgtggaccgtcagtattaatagcgccatcaacgatgggcaaaacgctcattac
gacgagagctgttcgagcaccctggcttccacgttcagcaatggtgccaaggatcccaat
attggagtggccaccaccgatctgtacggcaaatgcacgacgacgcacagtggaacgtca
gccgccgcgccggaagccgcaggagtgtttgccctcgcccttgaggccaacccacaattg
acctggcgcgacattcaacatttgacggttttaacctcgaagaggaattcattgttcgac
gcgaaaggaagatttcattggacgatgaacggggtcggcctcgaattcaatcatctgttc
ggttacggcgtgttggacgccggtgcaatggtcgctttggcaaagaaatggaaaactgtg
ccgccacggtatcattgcgaggctggttccgtgctcgaaactcaggaagtgacgagtgat
cgatcgatcttgttgaaaataaagactgatgcctgcgcggggaccgagtacgctgtcaac
tatctggaacacgtacaggccgtcatttcggtgaacgctacgcgacgtggcgatttggaa
ctgtttctaacctcccccatgggcaccagatcgatgattttgagccggagaataaacgac
gacgaccacagagacggtttcacgaaatggcctttcatgaccactcatacttggggggag
tatcctcaagggaattggttgttggaggtgagcttcaatactcaaacgcctcagcacgga
tggatcagagagtggaccctgatgctgcacggcaccagagagccgccttacaccgggctt
cctgcagccgatccacattccaaattggcgatcgtgaagaaagcgcacgaggaacgatcg
tcggctatgtaa

DBGET integrated database retrieval system