KEGG   Apis mellifera (honey bee): 408847Help
Entry
408847            CDS       T01057                                 

Gene name
GB12489
Definition
uroporphyrinogen-III synthase-like
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ame  Apis mellifera (honey bee)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    408847 (GB12489)
Enzymes [BR:ame01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     408847 (GB12489)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG5
AA seq 266 aa AA seqDB search
MALRYEKVVLCRGLSEKNDSQEAYVKTLKTAGYLCDCLPTLRFEFVNISELRTCFLSSSS
YYGLVLTSRRAAEAIELSAKEDPDILLPWKTLPVYCVGPATESFAKSHLGSENCFGKEAG
NAKELAELLVASIEKKSKPLLYPCSEIGRETIEKTLNENDIKIHKIVVYKTLASKTLEHD
LLKFMDNVPKIFIFFSPSTVEYIVTLLKKKSYDLNNIKAVAIGPVTRQALLDAGLKVFAT
ANKPDPVSLLDAINDADETEFNEKTE
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcattacgttacgaaaaagttgttttatgtcgtggtttatcagaaaaaaatgattcg
caagaggcgtacgttaaaaccttgaaaacggcaggttatttgtgcgattgtttgcctact
ttgcgctttgaattcgtaaatatttcggaattgaggacatgttttttatcatcatcttca
tactatggacttgtcctgacaagtcgtcgtgctgcagaggcaattgaactttctgcaaaa
gaagatcctgacattctacttccctggaaaactttaccagtatattgtgtaggaccagca
acagagtcttttgctaaaagtcacttaggttcagagaactgctttggtaaagaggctggt
aatgccaaagaattagcagaattgttagtggcctcgattgaaaaaaagtcaaaaccttta
ctttacccttgtagtgaaattggacgtgagacaatagaaaagactcttaatgaaaatgac
attaaaattcataaaatagttgtttataaaactttggctagtaaaactttagaacatgat
ctattaaaattcatggacaatgtgcccaagatcttcatattttttagtccatctacagta
gaatacatagtaacattattgaaaaaaaagtcttatgatctaaacaatataaaagcagtt
gctattggacctgtgactagacaagcattacttgatgctggtcttaaagtttttgccact
gcaaataaacctgatcctgtatctttgttggatgctattaatgatgctgatgaaactgaa
tttaatgaaaaaactgaatga

DBGET integrated database retrieval system