KEGG   Apis mellifera (honey bee): 408911Help
Entry
408911            CDS       T01057                                 

Gene name
GB14473
Definition
ubiquitin-specific protease 64E ortholog
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     408911 (GB14473)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   408911 (GB14473)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG7
AA seq 1282 aa AA seqDB search
MTMVCRAGQICFIQCSLSGFKDKFTSDRLLLHESTRGEELYVYIEEHCQIPQDSFQLYLV
SAGKLINLSEVKDKTMSEIGVDFSFDRESSSEHKPTLLVMDPTDILMQKQSSYCIMRHQS
AYNPPPPSPNHSSVWGEDNNIDFKSLIKSETNYVGLVNQAMTCYLNSLLQALYMTPEFRN
ALYNWEYIDGSEKDEANSIPYQLQKLFLNLQTSTKSAVETTSLTKSFGWDSTEAWQQHDI
QELCRVMFDALEQKFKNTEQADLINRLYEGKMIDYVKCLECGTEKSREDTFLDIPLPVRP
FGSNVAYTSVEEALRAFVQYEILEGSNQYHCEKCNKKCDAHKGLKFTKFPYLLTLHLKRF
DFDFKTFHRIKLNDKVTFPDTLNLNSFIASMPNLQESPSTDENNSLAKCDDNSITDSGTL
DDDCPPCENSLPNSNHSTNHDQDDDEGIDMSNGPSTSNCTMHNHENEKNRNSNAAKGPYN
YELFSIMIHSGSASGGHYYAYIKDFRTQEWFCFNDQSVTQITHDDIQKTYGGGSTRSYFS
GAYSSTNAYMLMYRQIDPTRNALPMQVQDFPKHIQELLKKMKENEDNDRKSREKDLATPK
VKVYCQHPTEDKKLNFRLSFLPNATWAETTKYVYKNFCLEGMVSLNQCRLVAYDPNNDLI
VASYEGREHETFANIWCHRVNRYSLLLEIRDKDQKFEPHLRGGIVTKLYVVDVARKKLIE
GPLNVRGLFTQTVKEYKQVVGKFVNMDPDDMKIVLRKHGTDTIFVQNDDAILAVAEFCNL
VKVFVCTNCDAECNKSYLETIISRIAEQLENIITLRIRLPPNPSKEMLEELNIPMLEEVC
KDKEKSVIDSPSKTSITESHNRDTGTKCNDILKSGKLIEDTPVRNASPQLGEGEEWHTPE
QSNSEDSSLSDSDKTLVGDAPGDDDFQLPYLPSSTSNRAIKMLNQVGIENWDNIIDDSEY
YFKATPYTNHNEKFLKVLVDKRMIFNTLKKNLEPYVGVPAEYFKICRYFDECGESDCSCL
LSQLVSYEDGEKLWIEIGRALRNGEFTVKLHQFFLDSAEGKFLFEWIVSEDMTVGQAKKE
ILAEMKRRYNIEIPYERCRLREKCFVLPSKVLLDHQKFKDFQFYSQFEMIVQELPDKDPV
TNSNQVIIFVRRWFPTKRHFGPPQEIVLDETTMEEMMKKLSLISDIPEKYINIMRGKGSV
HIPVVRVENDEDWIELTSGDELNVEDGAVFLYRDSRETSQPLTQEEYNDIAIREVSPFLP
LSSASRYNARKEKALRIYLDGE
NT seq 3849 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggtttgtagagctggtcaaatatgtttcattcagtgtagtctatctggattt
aaagataagtttaccagtgacagactactattacatgaatctacccgtggtgaggagctt
tatgtttatattgaagaacattgtcaaataccacaagacagttttcaattatatttagta
tcagctggaaaattgattaatttatcagaagtgaaagataaaacaatgtcagaaattggt
gtggatttttcttttgatcgagaatcttcaagtgaacacaaacccacattattagttatg
gatccaacagatatcctaatgcagaagcaatcatcatattgtattatgcgccatcaatct
gcatacaatcctcctccaccatctcctaatcattcatcagtatggggtgaagataataat
attgatttcaaaagtcttattaaatctgaaacaaattatgttggtttagtcaatcaagca
atgacatgttacttaaatagtctattacaagcattatatatgactcctgaatttcgaaat
gcattgtacaattgggaatacatagatggatcagaaaaagacgaagctaatagtattcca
tatcaattacagaagttatttttaaatttacagacatcaacaaaatcagcagtagaaact
acctcattaacaaaaagctttggttgggattctacggaagcttggcaacaacatgatatt
caagaactttgcagagttatgtttgatgctttagaacaaaaatttaaaaatactgaacaa
gctgatttgataaatagactttatgaaggaaagatgattgattatgttaaatgtcttgaa
tgtggtactgaaaagtcgagagaagatacttttcttgatataccattaccagtaagacca
tttggtagcaatgtggcatatactagtgtggaagaagctttaagagcatttgttcagtat
gaaattttggaaggaagtaatcaatatcattgtgaaaaatgtaataaaaaatgtgatgct
cataaaggattaaaattcacaaaatttccctatcttttaactcttcatcttaaacgattt
gattttgatttcaaaacttttcatagaattaaacttaatgataaagttacttttccggat
acattaaatttaaattcttttattgcttcaatgccaaatctccaagaatctccaagtact
gatgaaaataatagtttagcaaaatgcgatgataattctataacagatagtggcacatta
gatgatgattgtcctccctgtgaaaacagtcttcctaatagtaatcattcaacaaatcat
gatcaagatgatgatgaaggcatagatatgagtaatggaccttcaacatcaaattgtact
atgcataatcatgaaaatgaaaaaaatcgtaatagtaatgcagcaaaaggaccttataat
tatgaattattttcaattatgattcatagtggtagcgctagtggtgggcattactatgct
tatataaaagattttagaacacaagaatggttttgttttaatgatcaaagtgtaacgcag
ataactcatgatgatattcaaaaaacatatggtggtggttcaactagatcatatttcagt
ggagcttatagtagtactaatgcttatatgctcatgtatagacaaattgatcccactcgt
aatgctttacctatgcaagtacaggattttccaaaacatatacaggaattattaaaaaaa
atgaaagaaaatgaagataatgatagaaaaagtcgtgaaaaagatctagccacacctaaa
gtaaaagtatattgtcaacatcctacagaagataaaaaactgaattttagactttccttt
ttgcctaatgcaacttgggctgaaacgacaaagtatgtttataaaaacttttgtttggaa
ggcatggtaagcttaaatcaatgtcgtttagttgcttatgatcccaacaatgacttgatt
gtggctagctatgagggtagagaacatgaaacatttgcaaatatttggtgtcatcgagtg
aatcgatatagtttattattagaaatacgtgataaagatcaaaaatttgaaccacattta
cgaggtggtattgtaactaaattatatgtcgtcgatgtagctagaaaaaaacttattgaa
ggaccattaaatgtacgaggtttatttacacaaacagtgaaagaatataaacaagtagta
gggaaatttgttaatatggatccagatgatatgaaaatagttttacgaaaacacggaaca
gatacaatattcgtacagaatgatgacgctatattggcagttgcagaattttgtaattta
gttaaagtatttgtatgtactaattgtgatgctgaatgtaataaatcttatttggaaaca
ataatatctagaattgctgaacaattggaaaatattataactctacgcataagattacct
cctaatccaagtaaagaaatgttggaagaattaaatattcctatgttagaagaagtatgt
aaagataaagaaaaatctgtaattgacagtccatcaaaaacaagtattactgaatctcat
aatagagatactggtacaaaatgtaatgatattttaaagagtggaaaacttattgaagat
acaccagtaagaaatgcaagtcctcaattgggagagggtgaagaatggcatactccagaa
caaagtaatagtgaagatagtagtctgagtgatagtgacaaaacattagttggagacgct
ccaggagatgatgattttcaattaccttatcttccatcaagtacgagtaatcgagctatt
aaaatgttaaatcaagttggaatcgaaaactgggataatattatcgatgattcagaatat
tattttaaagctactccatatacaaatcacaatgagaaatttctgaaagtattagtagac
aaaagaatgatattcaataccttgaagaaaaatttagaaccatatgtgggtgtacccgca
gaatatttcaaaatttgtcgctattttgatgaatgtggtgaatcagactgtagctgttta
cttagtcagcttgtttcttacgaagacggagaaaaactttggatagagataggacgggct
ttacgtaatggtgaatttacagtaaagttgcatcaatttttccttgattcagctgagggc
aaatttttgtttgaatggatagtttcggaagatatgactgtaggtcaagcgaaaaaagag
attcttgcagaaatgaaaagaagatacaatatagagataccatacgaaagatgtcgatta
agagaaaagtgttttgtgttaccatcaaaagtacttttagatcatcaaaaattcaaggac
tttcaattttattctcaatttgaaatgattgtacaagagttacctgataaagatccagtt
accaatagtaatcaagttattatatttgtccgacgttggttccctacaaaaagacacttt
ggaccacctcaagaaattgttttagatgaaacaacaatggaagaaatgatgaaaaaatta
tctttgatatcggatatacctgaaaaatatataaatataatgagaggaaagggttcagta
catatacctgttgtacgagttgaaaatgatgaagattggattgaattaacatctggtgac
gaacttaatgttgaagatggtgctgtattcttatatagagatagcagggaaacttcacaa
ccattaacacaagaagagtacaatgatatcgcaattcgagaagtatcaccttttttacca
ctttcctctgcatcacgttataatgcgcgtaaagaaaaagcgcttagaatatatttggat
ggtgaatga

DBGET integrated database retrieval system