KEGG   Apis mellifera (honey bee): 408911Help
Entry
408911            CDS       T01057                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 47
  KO
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     408911
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   408911
Ubiquitin system [BR:ame04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    408911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
LG7
AA seq 1280 aa AA seqDB search
MVCRAGQICFIQCSLSGFKDKFTSDRLLLHESTRGEELYVYIEEHCQIPQDSFQLYLVSA
GKLINLSEVKDKTMSEIGVDFSFDRESSSEHKPTLLVMDPTDILMQKQSSYCIMRHQSAY
NPPPPSPNHSSVWGEDNNIDFKSLIKSETNYVGLVNQAMTCYLNSLLQALYMTPEFRNAL
YNWEYIDGSEKDEANSIPYQLQKLFLNLQTSTKSAVETTSLTKSFGWDSTEAWQQHDIQE
LCRVMFDALEQKFKNTEQADLINRLYEGKMIDYVKCLECGTEKSREDTFLDIPLPVRPFG
SNVAYTSVEEALRAFVQYEILEGSNQYHCEKCNKKCDAHKGLKFTKFPYLLTLHLKRFDF
DFKTFHRIKLNDKVTFPDTLNLNSFIASMPNLQESPSTDENNSLAKCDDNSITDSGTLDD
DCPPCENSLPNSNHSTNHDQDDDEGIDMSNGPSTSNCTMHNHENEKNRNSNAAKGPYNYE
LFSIMIHSGSASGGHYYAYIKDFRTQEWFCFNDQSVTQITHDDIQKTYGGGSTRSYFSGA
YSSTNAYMLMYRQIDPTRNALPMQVQDFPKHIQELLKKMKENEDNDRKSREKDLATPKVK
VYCQHPTEDKKLNFRLSFLPNATWAETTKYVYKNFCLEGMVSLNQCRLVAYDPNNDLIVA
SYEGREHETFANIWCHRVNRYSLLLEIRDKDQKFEPHLRGGIVTKLYVVDVARKKLIEGP
LNVRGLFTQTVKEYKQVVGKFVNMDPDDMKIVLRKHGTDTIFVQNDDAILAVAEFCNLVK
VFVCTNCDAECNKSYLETIISRIAEQLENIITLRIRLPPNPSKEMLEELNIPMLEEVCKD
KEKSVIDSPSKTSITESHNRDTGTKCNDILKSGKLIEDTPVRNASPQLGEGEEWHTPEQS
NSEDSSLSDSDKTLVGDAPGDDDFQLPYLPSSTSNRAIKMLNQVGIENWDNIIDDSEYYF
KATPYTNHNEKFLKVLVDKRMIFNTLKKNLEPYVGVPAEYFKICRYFDECGESDCSCLLS
QLVSYEDGEKLWIEIGRALRNGEFTVKLHQFFLDSAEGKFLFEWIVSEDMTVGQAKKEIL
AEMKRRYNIEIPYERCRLREKCFVLPSKVLLDHQKFKDFQFYSQFEMIVQELPDKDPVTN
SNQVIIFVRRWFPTKRHFGPPQEIVLDETTMEEMMKKLSLISDIPEKYINIMRGKGSVHI
PVVRVENDEDWIELTSGDELNVEDGAVFLYRDSRETSQPLTQEEYNDIAIREVSPFLPLS
SASRYNARKEKALRIYLDGE
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atggtttgtagagctggtcaaatatgtttcattcagtgtagtctatctggatttaaagat
aagtttaccagtgacagactactattacatgaatctacccgtggtgaggagctttatgtt
tatattgaagaacattgtcaaataccacaagacagttttcaattatatttagtatcagct
ggaaaattgattaatttatcagaagtgaaagataaaacaatgtcagaaattggtgtggat
ttttcttttgatcgagaatcttcaagtgaacacaaacccacattattagttatggatcca
acagatatcctaatgcagaagcaatcatcatattgtattatgcgccatcaatctgcatac
aatcctcctccaccatctcctaatcattcatcagtatggggtgaagataataatattgat
ttcaaaagtcttattaaatctgaaacaaattatgttggtttagtcaatcaagcaatgaca
tgttacttaaatagtctattacaagcattatatatgactcctgaatttcgaaatgcattg
tacaattgggaatacatagatggatcagaaaaagacgaagctaatagtattccatatcaa
ttacagaagttatttttaaatttacagacatcaacaaaatcagcagtagaaactacctca
ttaacaaaaagctttggttgggattctacggaagcttggcaacaacatgatattcaagaa
ctttgcagagttatgtttgatgctttagaacaaaaatttaaaaatactgaacaagctgat
ttgataaatagactttatgaaggaaagatgattgattatgttaaatgtcttgaatgtggt
actgaaaagtcgagagaagatacttttcttgatataccattaccagtaagaccatttggt
agcaatgtggcatatactagtgtggaagaagctttaagagcatttgttcagtatgaaatt
ttggaaggaagtaatcaatatcattgtgaaaaatgtaataaaaaatgtgatgctcataaa
ggattaaaattcacaaaatttccctatcttttaactcttcatcttaaacgatttgatttt
gatttcaaaacttttcatagaattaaacttaatgataaagttacttttccggatacatta
aatttaaattcttttattgcttcaatgccaaatctccaagaatctccaagtactgatgaa
aataatagtttagcaaaatgcgatgataattctataacagatagtggcacattagatgat
gattgtcctccctgtgaaaacagtcttcctaatagtaatcattcaacaaatcatgatcaa
gatgatgatgaaggcatagatatgagtaatggaccttcaacatcaaattgtactatgcat
aatcatgaaaatgaaaaaaatcgtaatagtaatgcagcaaaaggaccttataattatgaa
ttattttcaattatgattcatagtggtagcgctagtggtgggcattactatgcttatata
aaagattttagaacacaagaatggttttgttttaatgatcaaagtgtaacgcagataact
catgatgatattcaaaaaacatatggtggtggttcaactagatcatatttcagtggagct
tatagtagtactaatgcttatatgctcatgtatagacaaattgatcccactcgtaatgct
ttacctatgcaagtacaggattttccaaaacatatacaggaattattaaaaaaaatgaaa
gaaaatgaagataatgatagaaaaagtcgtgaaaaagatctagccacacctaaagtaaaa
gtatattgtcaacatcctacagaagataaaaaactgaattttagactttcctttttgcct
aatgcaacttgggctgaaacgacaaagtatgtttataaaaacttttgtttggaaggcatg
gtaagcttaaatcaatgtcgtttagttgcttatgatcccaacaatgacttgattgtggct
agctatgagggtagagaacatgaaacatttgcaaatatttggtgtcatcgagtgaatcga
tatagtttattattagaaatacgtgataaagatcaaaaatttgaaccacatttacgaggt
ggtattgtaactaaattatatgtcgtcgatgtagctagaaaaaaacttattgaaggacca
ttaaatgtacgaggtttatttacacaaacagtgaaagaatataaacaagtagtagggaaa
tttgttaatatggatccagatgatatgaaaatagttttacgaaaacacggaacagataca
atattcgtacagaatgatgacgctatattggcagttgcagaattttgtaatttagttaaa
gtatttgtatgtactaattgtgatgctgaatgtaataaatcttatttggaaacaataata
tctagaattgctgaacaattggaaaatattataactctacgcataagattacctcctaat
ccaagtaaagaaatgttggaagaattaaatattcctatgttagaagaagtatgtaaagat
aaagaaaaatctgtaattgacagtccatcaaaaacaagtattactgaatctcataataga
gatactggtacaaaatgtaatgatattttaaagagtggaaaacttattgaagatacacca
gtaagaaatgcaagtcctcaattgggagagggtgaagaatggcatactccagaacaaagt
aatagtgaagatagtagtctgagtgatagtgacaaaacattagttggagacgctccagga
gatgatgattttcaattaccttatcttccatcaagtacgagtaatcgagctattaaaatg
ttaaatcaagttggaatcgaaaactgggataatattatcgatgattcagaatattatttt
aaagctactccatatacaaatcacaatgagaaatttctgaaagtattagtagacaaaaga
atgatattcaataccttgaagaaaaatttagaaccatatgtgggtgtacccgcagaatat
ttcaaaatttgtcgctattttgatgaatgtggtgaatcagactgtagctgtttacttagt
cagcttgtttcttacgaagacggagaaaaactttggatagagataggacgggctttacgt
aatggtgaatttacagtaaagttgcatcaatttttccttgattcagctgagggcaaattt
ttgtttgaatggatagtttcggaagatatgactgtaggtcaagcgaaaaaagagattctt
gcagaaatgaaaagaagatacaatatagagataccatacgaaagatgtcgattaagagaa
aagtgttttgtgttaccatcaaaagtacttttagatcatcaaaaattcaaggactttcaa
ttttattctcaatttgaaatgattgtacaagagttacctgataaagatccagttaccaat
agtaatcaagttattatatttgtccgacgttggttccctacaaaaagacactttggacca
cctcaagaaattgttttagatgaaacaacaatggaagaaatgatgaaaaaattatctttg
atatcggatatacctgaaaaatatataaatataatgagaggaaagggttcagtacatata
cctgttgtacgagttgaaaatgatgaagattggattgaattaacatctggtgacgaactt
aatgttgaagatggtgctgtattcttatatagagatagcagggaaacttcacaaccatta
acacaagaagagtacaatgatatcgcaattcgagaagtatcaccttttttaccactttcc
tctgcatcacgttataatgcgcgtaaagaaaaagcgcttagaatatatttggatggtgaa
tga

DBGET integrated database retrieval system