KEGG   Apis mellifera (honey bee): 408917Help
Entry
408917            CDS       T01057                                 

Gene name
erk7, GB11031
Definition
mitogen-activated protein kinase 15-like
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     408917 (erk7)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   408917 (erk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG4
AA seq 526 aa AA seqDB search
MSSKNTNEKVLEIDAHVSKHYDIVRRLGKGAYGIVWKAIDKKNKDTVAVKKIFDAFRNQT
DAQRTFREIMFLLSFANHDNIIRLIGLHKANNDRDIYLVFEYMETDLHNVIKKGKILKDL
HKVFIMYQLFKAIKYIHSGNVIHRDLKPSNVLLNAHCHCKIADFGLARSVTQIGEGDGET
ASDPTLTDYVATRWYRAPEILVASKRYTKGIDMWSLGCILGEMLLGKPLFPGSSTINQVE
RIMATLPPPTREDLISVSAGYGTNLLEKTPNAPRRSLKELLPEVSEKALSLISNLIVFNP
NHRLTAVEALEHPYVADFHRRSNEPERGSSVVPLLRDDVQLSVDEYRNKLYSMMDEKHRK
HKNMSKSRIRRLSEHIRKETVSSNSNPVIGQGDAIVGKNLTHSYQDLRKERGRSDAYEPS
YVEVRSQLPNKKTTRHSQIFSDERVTKTRSITMEMQTQNPKNLRPPVKNVATQYTHNFVN
GNLTNLTPSTTKSCLYLNQQHRPLSKSQRSIQSDQPVVATCRVGFI
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaaaaaataccaacgaaaaggttttggagatcgatgcacacgtcagcaaacat
tatgacatcgttcgacgtcttggcaaaggggcttacggtatcgtatggaaggcgatagac
aagaaaaacaaggacacggtagcggtgaagaagatcttcgacgccttcagaaaccagacg
gacgcacagcgcacattccgtgagataatgttcttactgtcgttcgccaatcacgacaac
atcatacgattgatcggtcttcacaaggcgaacaacgaccgggacatttatctcgtgttc
gagtacatggaaaccgatctccacaacgtgattaaaaagggcaagatcctgaaggacctc
cacaaggtgttcatcatgtatcagctgtttaaggcgatcaaatacattcattcggggaac
gtgatacacagagacctgaagccatcaaacgttctactaaatgctcattgtcattgtaaa
atcgctgattttggactggcacggtcggtcactcagataggagagggggatggtgagact
gccagcgatcctacgctcacggattacgtggcgactcgctggtaccgggcaccggaaatc
ctcgttgcttcgaaaaggtacacgaagggtatcgatatgtggtcgctcggatgtattctc
ggcgaaatgctccttggaaagccattgtttcctggttcgtcgacgataaatcaagtggag
agaataatggccactcttccgccacctacaagagaagatctgatttcggttagcgccgga
tacggcaccaatttgttggagaaaacgccgaatgcaccgagacgctcgttgaaggaattg
ttgccagaggtgtcggagaaagcattgagcctcatcagcaatcttatagtgttcaatcct
aatcacagattaaccgctgtagaggctctggaacatccttatgtggccgattttcacaga
agaagcaacgaaccggaaagaggttcgagcgtggtacctctgctcagggacgatgtacag
ctctccgtcgacgagtacagaaataagctttattcgatgatggacgagaagcatcgcaag
cataagaatatgtctaagtccagaatcaggcgattatcggagcacatcaggaaggaaaca
gttagtagtaatagtaatccagttatcggtcaaggcgacgcgattgttggtaaaaatctt
acacactcatatcaagatttacgtaaggagagaggtagaagcgacgcatacgagccctct
tacgtagaagtacgttcgcaactgccaaacaaaaagacgacacggcattcgcaaattttt
agtgatgaaagagttacgaagacgagatcgataactatggagatgcagacgcaaaatcca
aaaaatcttcgaccacctgttaaaaatgtagcaactcagtacacgcacaactttgtgaac
ggcaatctgactaatttgacaccgagcacgaccaaaagctgtttatatctgaatcaacaa
caccgaccattatccaaatctcaacgttcgatacaatccgatcaaccagtggtggctacg
tgtcgcgtgggattcatttag

DBGET integrated database retrieval system