KEGG   Apis mellifera (honey bee): 408964Help
Entry
408964            CDS       T01057                                 

Gene name
GB14674
Definition
uncharacterized LOC408964
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
ame  Apis mellifera (honey bee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG8
AA seq 987 aa AA seqDB search
MSYHRGGQAGAVAVSYSTSPMAPHSPSRRCSSNNSGNNSSAIGTSTSKLNTYRSTASSSI
LDRPTNFYSTSSSTSSSSGSSGFRSNYTTEYRRSYCPSGSFYSSTGTSIRRSYLSEYNRS
RCSPTRSVSSSAYSSTGSGSGTGTNVTTNGTSGTRFGLSTSSSSSSISAGGSSRDRGIPE
SSSRLEITADLIRYSPSGYIPNIRQTSSTTGSTSGIHHHHHHHHQWKHHSTGSSLTELFG
GDDRDVAVERTGRDHRPESSLSSSSSSSSCAVGGALWSRSKRRPLSSSTVLNSGHARADS
AASPGEVTINERATIRDLDDEDDDDDDDDDDDDDDDNDDDDEDEDGNNTDDDQHNNNNNG
NNSSGAEDTCDSARYGSNNNNNNNRDRDRDRDDKDDKDDGDDEDKNKLNNRHHRQQQQQR
GAAHRIDEVSPAKRNLLSSIPGGGAGGAGLIGVKLDLLTNLATNPSNGQLLINNNNNGRK
IIQEGVEEKEEDVEIKDVEGGNRGEVIHGINEAAISVDAIAFLRGGRTGDPECLEHGEEQ
RTASTSYDIDQTGFVGGITPPILQNGVAGRPSGTYGDDPSVPSTSRRPDGHFAGTNTARN
LTSSSPTAPSTAHQNLYRGVVDQFEGSPTNKSARNRLQAHRDERCGLNGLRNIGNTCFMN
SVIQCLSNTRPLLEYLLNEQYLADINTTTSSMKGALIKAFSQVIHELWEVGGDLVVNTTA
LKSQIQRFAPRFMGYSQQDAQEFLRYLLEGLHEDVNRVTVKPQPIHTDIPEMYTDSQKAV
ESWKRYLRSEDSMIVDVFVGQLRSSLHCTSCDHVSVTLDPFWDLSLPIPARSGTVKLSQC
LEHFTREEVLDGDEKPTCSKCQMRRKCTKSFSIQKFPKILVIHLKRFSPMERFRSKLNVM
VDFPLTGLDLSAFAAPRVPGCTYNLYGVANHSGTTHSGHYTAYCKHPYSAEWHEYNDSRV
SAVPARSVVSNEAYVLFYEQQPHSSHL
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtatcaccgtgggggccaggcgggcgccgtagcagtttcgtacagcaccagtcca
atggcaccgcattctcctagcagacgatgttccagcaataacagcggcaacaacagttcc
gctattggcacctccacctcgaagctgaacacctacagatctactgcttcctcgtcgatc
ttagatcgaccaacaaatttctactcgacatcgtcgtcgacgtcatcgtcgtcgggcagc
tcgggctttcgttcgaactatacgaccgagtacaggcgatcctactgcccatcaggcagt
ttctactcatcaacgggtacgagcatccgaaggagttacttatcggaatacaaccggtct
cgctgctcacccacaaggtcagtttcgtcgtcggcgtacagcagtacgggtagcggtagt
ggtacgggcacgaatgtgacgacgaacggaaccagcggcactagattcggcttgtctaca
tcgtcgtcctcatcgagcatctctgccggcggttcgtccagagacagagggatccccgaa
tcctcgtctaggctagaaataacggcggacttgatcaggtattcgccgtccggttacata
ccgaatatccgtcaaacgagcagcaccactggcagcaccagtgggatccaccatcatcat
caccatcaccaccagtggaagcaccactcgaccggttcgtcgttgacggagttgttcggt
ggtgacgatcgtgacgtagccgtcgaacgtaccggcagagatcatcgtccagagtcgtcg
ctctcctcgtcctcctcgtcatcttcctgcgccgttggtggtgcactctggtccaggtcg
aagagaaggccactgtccagcagcacggtgctcaacagcgggcatgcacgcgcggacagt
gccgcgtcgcctggcgaggtaacgattaacgagcgcgccacgatccgcgacctagacgac
gaggacgacgacgacgacgacgacgatgacgacgacgacgacgatgacaacgacgacgac
gacgaggacgaggacgggaacaacaccgacgacgatcaacacaacaacaacaataatggg
aataacagcagcggtgccgaggacacgtgcgattccgctcgatatgggtcgaacaataac
aacaacaacaaccgtgaccgtgaccgcgaccgcgacgacaaggacgacaaggacgacggg
gacgacgaagacaagaacaagctgaacaaccggcatcatcgccaacagcagcagcaacgc
ggtgctgcccatcggatcgacgaggtttcaccagctaagcgtaacctcttgtcgtctata
cccggtggcggtgctggcggtgctggtttgatcggtgttaagctcgacttgctcactaac
ctagccactaatccgagtaacggccaactgctgattaacaacaacaacaacggtcggaag
attatccaagaaggtgtggaagagaaggaggaagacgtcgagatcaaagacgtcgagggc
gggaatcgtggcgaggtaatacacgggatcaacgaggccgccatctctgtcgacgcgatt
gcgttcctacgtggtggtcgtaccggggatccagagtgtctcgaacacggtgaggagcaa
cggaccgcgtctacctcgtacgatatcgatcagaccgggttcgtaggcggcattacgccg
cccatcttgcaaaacggcgtggcgggaagaccgtccggtacttatggggacgacccatcc
gtgccttctacatccaggagaccggatggtcacttcgcggggacaaacactgccaggaat
ctgacttcctcgtcgcccaccgcaccgtccacggctcaccaaaatctctatcgcggggtc
gtcgatcagtttgaaggaagccctacgaataaatcggctcgtaatcgattacaggcgcat
cgcgatgagcgatgtggactaaacggattacgaaatatcgggaatacatgtttcatgaac
agtgtgatccaatgtttgagcaatacgagaccgttactggaatatctgctgaacgaacag
tacctcgctgatataaacactaccacaagcagtatgaaaggagcattgatcaaagcgttt
agtcaggtgatacatgagttatgggaagtgggtggtgatctcgtggttaatacgacggcg
ctcaaatctcaaatacaaagattcgcaccacgttttatgggatacagccaacaggatgct
caagagtttcttaggtatctattagaaggattacacgaggatgtgaacagggtgacggtg
aaaccgcaaccgatacacacggatattcctgaaatgtacacagacagtcagaaggcagta
gaaagctggaaacgctacttacgtagtgaagatagtatgatagtggacgttttcgtgggt
caattacgttcgtcgttacattgcacttcttgtgaccatgtgtcagtcacattggatcct
ttctgggatctcagtttgccaataccggctagaagtggtacagtgaagttgagccaatgt
ttggagcatttcacgcgagaagaggtgctcgacggtgatgaaaaaccgacttgttccaag
tgtcagatgaggagaaagtgcacgaaaagtttcagcatacaaaagttcccgaaaattctt
gttattcacttaaaacgtttctcaccaatggaacgattccgcagcaagctaaatgtgatg
gtagattttccattgacaggtttggatctcagtgcctttgctgcgcctagagttccgggt
tgtacgtacaatttatacggtgtcgcgaaccattcgggcacaacacactccggtcattac
acagcatattgtaagcatccatactcggcagaatggcacgagtacaatgatagccgggtg
tccgcggttccagcgcgatcggtcgtttccaacgaagcctacgtactgttctacgagcag
cagcctcacagctctcacttgtaa

DBGET integrated database retrieval system