KEGG   Apis mellifera (honey bee): 408982Help
Entry
408982            CDS       T01057                                 

Gene name
elm, GB13017
Definition
ethanol sensitive with low memory
Orthology
K17610  
calcineurin B homologous protein 1
Organism
ame  Apis mellifera (honey bee)
Brite
Protein phosphatases and associated proteins [BR:ame01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     408982 (elm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG9
AA seq 189 aa AA seqDB search
MGNRSSLLLREEEIAQIQEATGFTPNQIERLYSRFTSLDRGDCGTLSREDFLRIPELAIN
PLGDRIVNAFFDESGNDRVNFLQFMQVLAHFRPIKKNSPNRLNSRQEKLKFAFKMYDLDN
DDLISKDELLAILHMMVGANISEEQLTSIAERTIVEADENGDGMISFEEFCKALERTDVE
QKMSIRFLS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatagatctagccttcttctacgcgaagaagaaatagcacaaatccaagaagcc
actggatttacaccaaaccagattgaacgtttatatagtcgttttacaagtcttgatcgt
ggagattgtggaactcttagtagagaagatttccttagaattccagaattggcaataaat
cctcttggtgatagaattgtaaatgctttctttgatgaaagtggtaatgatagggtgaat
ttcttacaatttatgcaagtgctggctcacttcagacccattaaaaaaaatagtcctaat
agattaaattctagacaagagaaattaaaatttgctttcaaaatgtatgatttggataat
gatgatttaatatcaaaagatgaattattagctattttgcatatgatggttggtgcaaat
attagcgaggaacagttaactagtattgcagaaagaactatagtagaggctgatgaaaat
ggtgatggaatgatttcatttgaagagttttgtaaagcattagagaggacagatgtagaa
caaaaaatgtctatacgatttcttagttaa

DBGET integrated database retrieval system