KEGG   Apis mellifera (honey bee): 408991Help
Entry
408991            CDS       T01057                                 

Gene name
nemy, GB16408
Definition
no extended memory
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ame  Apis mellifera (honey bee)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    408991 (nemy)
   00330 Arginine and proline metabolism
    408991 (nemy)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    408991 (nemy)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     408991 (nemy)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG9
AA seq 766 aa AA seqDB search
MQQQRRVAVRRLVNFNAGCEVAHVPYSPASFPAADTTDPFSSQYLVSYCRDVEGLSRRRH
SSLVCLCAEITSVHDPPSLPPLPLSHAPLESIHSLACRPLTFLNPYITIRSNRIRRGKNL
GIESYPVSIPNAKRMNRREAIVRGVRMLKIVKAGSNGLRKLHTSNKRRAAVPASKKLGTL
KYLDAAFGSALELERAQTRTRDQDQATNAEDVLFDMFKNEDTGLLAVGKFLAALRTTGLR
NDDPRLQEFTDNLRKEHLKTGGHEGVSHETQKLSRDQFRRIINPNIVLISRAFRHQFIIP
DWSGFTKHIEDFYWKCKSNSEGKVASYIPQLARMNPDYWGVSVCTIDGQRFSIGDTSIPF
TLQSCSKPLTYAIALDRLGQEVVHQYVGQEPSGRNFNELVLDYNKKPHNPMINAGAILVC
SLLKSLIKPEMTLAEKFDFTMNYFKRLAGGENMGFNNAVFLSEREAADRNYALGFYMREY
NCYPDKSNLREIMDFYFQCCSMEANCDTMAVMAATLANGGICPITEEKVLKPDSVRDVLS
LMHSCGMYDYSGQFAFKVGIPAKSGVSGSLLVVIPNVMGICTWSPPLDPLGNSCRGVQFC
EELVSEFNFHSTYYDHRYDNLKHATNKKDPRRHKYETKGLSIVNLLFSAASGDVTAMRRH
RLSGMDMTLSDYDGRTALHLASSEGHLDCVEFLIEQCAVPHDPKDRWGKRPIDEAETFGH
MQVVEYLNNYALARKTEIENEEKENNNNDERNSRTVAESAIQTPLP
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaacagaggcgagtagcggttcgtcgtctggtgaatttcaatgccggctgcgaa
gtcgcgcatgtgccctattcgccggcttctttccctgccgccgatacgaccgaccctttc
tcgtctcagtatctcgttagttattgccgggacgtcgagggtctctcgcgtcgccgccac
tcgtcgcttgtgtgcctgtgtgccgaaataacgagtgtacacgatcctccttcgctcccc
cctctccccctctctcacgcgccactcgagtctatccactcactcgcctgtcgtccactc
actttcctaaatccttatattacaattcgatcgaatcgaattcgacgaggcaagaatctc
gggatcgaatcgtatcccgtctcgataccgaacgcgaagcgaatgaatcgtcgagaggcg
atcgtcaggggtgtgaggatgctgaaaatcgtcaaggctggctcgaacggattaagaaag
ctgcacacgagcaataagaggcgagccgctgtaccagcgtcgaagaagctgggaacctta
aagtacttggacgctgctttcggaagtgccttagaattagaacgagcccaaacccgtact
agagatcaagatcaggcgactaatgcggaagatgtcctctttgatatgtttaaaaacgaa
gataccggtcttctagcagtgggcaaatttttggccgctctgaggactaccggtttgcga
aacgacgatcccaggctccaagaattcacggataacttgaggaaggaacacttgaagacc
ggaggtcacgaaggtgtatctcacgagacgcaaaaattgagcagagatcagtttagaaga
attataaatccgaacatagtgttgatctcacgggcgttcaggcaccaattcatcataccc
gattggtcgggtttcaccaagcacatagaggacttctattggaaatgcaagtcgaactcg
gagggcaaggtcgcctcttatataccacagctggcaaggatgaatccggattactggggc
gtttccgtttgcacgatcgatgggcagaggttcagcatcggtgacacctcgatccccttt
accttgcaaagttgcagcaagcctctgacttacgcgatcgctctggacaggttggggcag
gaagttgtccatcagtatgtcggccaggaaccgtccggacgcaacttcaacgagctggtg
ttggattacaacaagaaaccccataatcccatgatcaacgctggcgcgatcctagtctgt
tctctcttgaagtctctgatcaagcctgaaatgactttagccgaaaaattcgacttcacg
atgaattattttaagaggctagcaggtggggagaacatgggcttcaacaacgctgtattt
ttatcggaacgagaagcggctgacagaaattacgcgcttggattttacatgagggagtac
aattgttatcccgataaatcaaatttgagagaaatcatggatttctatttccagtgctgc
tccatggaggccaactgcgacacgatggcagtaatggcagccactttggctaacggtggc
atttgtcccataaccgaagaaaaagttctaaaacctgacagcgttcgagacgttttaagt
ttgatgcacagctgtggaatgtacgattacagtggccaatttgcattcaaggttggtatc
ccagcgaagtcgggagtgtcgggaagtcttttggtagtgataccaaacgtgatgggcatt
tgcacgtggtcaccaccgttggatcccctcggaaattcttgcagaggtgtccaattttgc
gaggaactcgtctccgagtttaattttcatagcacctactatgatcacaggtacgacaac
ttgaagcatgcgactaataaaaaggatccgagaaggcacaaatacgagacgaaaggattg
tcgatcgttaatcttttgttcagcgcggccagtggcgatgtcacagcgatgagaaggcat
cgattgagcggtatggatatgacattgtcggattacgacggtaggacagctttgcattta
gcttccagtgagggacatttagattgtgtcgaatttcttatcgagcagtgtgcagttcct
cacgatcctaaggacaggtggggaaagaggccgatcgatgaagcagaaacatttggacac
atgcaagtagtagaatatctgaataattacgctttggcccgaaaaactgaaatagaaaat
gaagaaaaggagaataacaataatgatgaaaggaattcccgaacagtcgctgaatctgca
attcaaacgccattaccataa

  All links  
No link information was found.   
DBGET integrated database retrieval system