KEGG   Apis mellifera (honey bee): 408991Help
Entry
408991            CDS       T01057                                 

Gene name
nemy
Definition
(RefSeq) glutaminase kidney isoform, mitochondrial
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00220  Arginine biosynthesis
ame00250  Alanine, aspartate and glutamate metabolism
ame00471  D-Glutamine and D-glutamate metabolism
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    408991 (nemy)
   00220 Arginine biosynthesis
    408991 (nemy)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    408991 (nemy)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     408991 (nemy)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_4 Ank_2 Ank Ank_5 Ank_3 Phosphatase
Motif
Other DBs
NCBI-GeneID: 408991
NCBI-ProteinID: XP_006567517
BEEBASE: GB53310
Position
LG9
AA seq 632 aa AA seqDB search
MNRREAIVRGVRMLKIVKAGSNGLRKLHTSNKRRAAVPASKKLGTLKYLDAAFGSALELE
RAQTRTRDQDQATNAEDVLFDMFKNEDTGLLAVGKFLAALRTTGLRNDDPRLQEFTDNLR
KEHLKTGGHEGVSHETQKLSRDQFRRIINPNIVLISRAFRHQFIIPDWSGFTKHIEDFYW
KCKSNSEGKVASYIPQLARMNPDYWGVSVCTIDGQRFSIGDTSIPFTLQSCSKPLTYAIA
LDRLGQEVVHQYVGQEPSGRNFNELVLDYNKKPHNPMINAGAILVCSLLKSLIKPEMTLA
EKFDFTMNYFKRLAGGENMGFNNAVFLSEREAADRNYALGFYMREYNCYPDKSNLREIMD
FYFQCCSMEANCDTMAVMAATLANGGICPITEEKVLKPDSVRDVLSLMHSCGMYDYSGQF
AFKVGIPAKSGVSGSLLVVIPNVMGICTWSPPLDPLGNSCRGVQFCEELVSEFNFHSTYY
DHRYDNLKHATNKKDPRRHKYETKGLSIVNLLFSAASGDVTAMRRHRLSGMDMTLSDYDG
RTALHLASSEGHLDCVEFLIEQCAVPHDPKDRWGKRPIDEAETFGHMQVVEYLNNYALAR
KTEIENEEKENNNNDERNSRTVAESAIQTPLP
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcgagaggcgatcgtcaggggtgtgaggatgctgaaaatcgtcaaggctggc
tcgaacggattaagaaagctgcacacgagcaataagaggcgagccgctgtaccagcgtcg
aagaagctgggaaccttaaagtacttggacgctgctttcggaagtgccttagaattagaa
cgagcccaaacccgtactagagatcaagatcaggcgactaatgcggaagatgtcctcttt
gatatgtttaaaaacgaagataccggtcttctagcagtgggcaaatttttggccgctctg
aggactaccggtttgcgaaacgacgatcccaggctccaagaattcacggataacttgagg
aaggaacacttgaagaccggaggtcacgaaggtgtatctcacgagacgcaaaaattgagc
agagatcagtttagaagaattataaatccgaacatagtgttgatctcacgggcgttcagg
caccaattcatcatacccgattggtcgggtttcaccaagcacatagaggacttctattgg
aaatgcaagtcgaactcggagggcaaggtcgcctcttatataccacagctggcaaggatg
aatccggattactggggcgtttccgtttgcacgatcgatgggcagaggttcagcatcggt
gacacctcgatcccctttaccttgcaaagttgcagcaagcctctgacttacgcgatcgct
ctggacaggttggggcaggaagttgtccatcagtatgtcggccaggaaccgtccggacgc
aacttcaacgagctggtgttggattacaacaagaaaccccataatcccatgatcaacgct
ggcgcgatcctagtctgttctctcttgaagtctctgatcaagcctgaaatgactttagcc
gaaaaattcgacttcacgatgaattattttaagaggctagcaggtggggagaacatgggc
ttcaacaacgctgtatttttatcggaacgagaagcggctgacagaaattacgcgcttgga
ttttacatgagggagtacaattgttatcccgataaatcaaatttgagagaaatcatggat
ttctatttccagtgctgctccatggaggccaactgcgacacgatggcagtaatggcagcc
actttggctaacggtggcatttgtcccataaccgaagaaaaagttctaaaacctgacagc
gttcgagacgttttaagtttgatgcacagctgtggaatgtacgattacagtggccaattt
gcattcaaggttggtatcccagcgaagtcgggagtgtcgggaagtcttttggtagtgata
ccaaacgtgatgggcatttgcacgtggtcaccaccgttggatcccctcggaaattcttgc
agaggtgtccaattttgcgaggaactcgtctccgagtttaattttcatagcacctactat
gatcacaggtacgacaacttgaagcatgcgactaataaaaaggatccgagaaggcacaaa
tacgagacgaaaggattgtcgatcgttaatcttttgttcagcgcggccagtggcgatgtc
acagcgatgagaaggcatcgattgagcggtatggatatgacattgtcggattacgacggt
aggacagctttgcatttagcttccagtgagggacatttagattgtgtcgaatttcttatc
gagcagtgtgcagttcctcacgatcctaaggacaggtggggaaagaggccgatcgatgaa
gcagaaacatttggacacatgcaagtagtagaatatctgaataattacgctttggcccga
aaaactgaaatagaaaatgaagaaaaggagaataacaataatgatgaaaggaattcccga
acagtcgctgaatctgcaattcaaacgccattaccataa

DBGET integrated database retrieval system