KEGG   Apis mellifera (honey bee): 408996Help
Entry
408996            CDS       T01057                                 

Gene name
norpA2, GB14619
Definition
no receptor potential A2
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ame  Apis mellifera (honey bee)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ame00562]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:ame04310]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ame04070]
Organismal Systems; Sensory system; Phototransduction - fly [PATH:ame04745]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG9
AA seq 1104 aa AA seqDB search
MTKRFEFNWQIEVPLALRQGCVFDRWSEEKDNTELELNCVFKVDEYGFFIYWQSEGRDGD
VIELCQVSDIRAGGLPKDPKLYDKLVTKHGEQLEEKCLTICSGVDYTNINYQHVVCPDSA
TAKIWLDGIRSITHNVKANNVCPLTCLKKHWMRLRMLIDPNGKVPVKVVARTFASGKTEK
LVYQCLADLGLSSGKNDVIEPEDFTFDAFYALYHKICPRNDIEELFQSITQGKADTINLD
QLVMFLNEKQRDPTLNEILYPLYDEKRALEIINDYEQNEMARNQKTMTKDGFIRYLMSDE
NAPVFLDRLDVYMDMDQPLAHYYINSSHNTYLCGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDEEPIITHGKAMCTDILFKDVIYAVRDTAFVTSEYPVILSFENHCSKKQQYKL
AKYCDEILGDLLLKEPLKDYPLEPGVPLPSPNLLKRKILIKNKRLKPEVEKHELELFRQG
QFVIEDEVKEDASAPPSVAVVVEQQSVKEEVSTTESVASSTTGNQQQSSSSTGLGETLDI
PVPPYTGSTTNVHPWLSSMVNYAQPIKFPGFDVAEQKNIHHNMSSFAETAGLNYLKTQAI
EFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQTADLPMQLNQGKFEYNG
SSGYLLKPDFMRRADRSFDPFAESPVDGVIATQCSVQVIAGQFLSDKKVGTYVEVEMYGL
PTDTIRKEFRTRVVPANGLNPVYNEEPFLFRKVVLPDLAALRFAVYDESNGKLLGQRIVP
LDGLQSGYRHISLRTEANFPMSLPMLFCNIEIKIYVPDGYEGLMDALTAPRAYKKSENAS
QNKMRGLGIEESDSKGHCDSAPAHHREAPKPREEMKFNPITAESLRQEKGYQKVLRKQQK
DLESLKKRHQKEKLTVQKQHCTAIEKIIKGKNKAELSRDPIVRREVSEQTVQWSRLADKQ
RREERDLIRSHLEERRNTLRKLCVAAQLAQQKQLTARHEREIKEMNARQARLSVESTREV
MNDKTLKTRGIKEGRLREKQQNNTKKFMEERRIAQMIQNREKEKLKVIHEKQLEELQKDM
NAVMDMYNNEEMEYELGPKTECYV
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaagattcgagttcaattggcagatcgaggtacccttagccctccgtcaggga
tgcgtgttcgatcgatggtcggaagagaaggacaacacggagctcgagctgaattgcgtg
ttcaaggtcgacgaatatgggttcttcatctactggcagagcgaaggaagggacggggac
gtgatagagctgtgtcaagtgagcgatatacgcgccggcggattaccaaaggacccgaag
ctgtacgacaagcttgtgacaaagcacggggagcaattagaggagaaatgtttaaccatc
tgttcgggcgtagattataccaatattaattaccagcatgtcgtttgcccggattcagct
acggccaagatatggctggatggcatacgatcgattacgcacaacgtgaaagccaacaac
gtttgcccgcttacgtgcttgaagaaacattggatgaggcttagaatgctgatcgatccg
aatggaaaagttccggtgaaagtggtcgcgagaactttcgcatctgggaaaacggaaaag
cttgtttatcagtgcctcgccgatttaggtctatccagcgggaagaacgatgtgatcgag
cctgaagacttcaccttcgacgctttctacgcgttgtaccataaaatctgccctcgaaac
gacatagaggaattgttccaatccatcacccagggcaaagcggacacgatcaatctcgat
caattggtcatgttcctgaacgagaagcaacgagatccaacgttgaacgagatcttgtac
ccgttgtacgacgagaagagggcgttggagataataaacgattacgagcagaacgagatg
gcgaggaatcaaaaaacgatgacgaaggacggtttcataaggtacctgatgtcagacgaa
aatgcccccgtattcctggacaggctggacgtttacatggacatggatcaaccgctcgcg
cattactacatcaactcgagccacaacacgtacctgtgcggccgtcaattcggcgggaag
agcagcgtcgagatgtacaggcaggtgttgttggccggttgcaggtgcgtcgagttggat
tgttgggatggaaaaggggaggacgaggagccgataattacgcatggcaaagctatgtgc
acggacattctcttcaaggacgtgatttacgcggtgagggacacagcgttcgtcacgtcg
gaatatccggtcattcttagcttcgagaaccattgcagcaagaagcagcagtacaaattg
gccaaatactgcgacgaaattctgggcgatctgcttctcaaggaaccgctcaaagactat
ccactggagccaggagtacctctgccgtcgcccaatctgctcaaacgtaagattctgata
aagaacaaacgtttgaaacccgaggtggagaagcacgagttggaattgttccggcaaggc
caattcgtcatcgaggacgaggtcaaggaagacgcgagcgcgcctccctccgtcgctgtt
gtcgttgaacaacaatcggtaaaggaagaggtttcgacgaccgagtcagtcgcatcgtcg
acgaccgggaaccagcaacagtcgagctcgagcacgggattgggcgaaactctggacata
cccgttcctccgtatacaggaagcacgacaaacgtccacccatggttgtcctcgatggtc
aactacgcgcagcccatcaagttcccaggcttcgatgttgccgaacaaaagaatattcat
cacaatatgtcttccttcgcggaaaccgctggcctcaattacttgaagacccaagcgatc
gagttcgtcaattacaacaagcggcaaatgagccggatttatccgaaaggaacccgagcg
gattcatcgaattacatgccacaggtcttctggaacgctggttgtcaaatggtgtcgttg
aatttccaaaccgcggacctgcccatgcaactgaatcagggcaagttcgagtacaacggc
tcgtccggctacctactcaaacctgacttcatgagacgtgccgatcgaagcttcgacccg
ttcgcggagagccctgtggacggtgtgatcgccacccaatgcagcgttcaggtgatcgct
ggtcaatttttatccgacaagaaggtcggcacttacgtggaggtggagatgtacggtcta
ccgacggacacgatcaggaaagaatttcggaccagggttgttcctgcgaacggcttgaat
cccgtttacaacgaggagcctttcctgtttcgaaaagtcgtgctgccggatctggccgcc
ctcagattcgctgtttacgacgagtcgaacgggaagctgttgggccaaaggatcgtcccg
ttagacggtctacagtcgggatacaggcacatatccctgaggacggaggcgaacttcccc
atgtccttgcccatgctgttctgcaacatagagatcaagatttacgtgccggacgggtac
gaggggctcatggacgcgctcacggcgccacgggcctacaagaagtcggagaacgcgtct
cagaataagatgcgcgggcttgggatagaggagagcgacagcaaagggcactgtgactcc
gcgcccgctcatcatcgggaagcgcctaaacctcgagaggaaatgaaattcaatccgata
acggctgaatcgttgaggcaagagaaggggtatcagaaagtgttgagaaagcagcagaag
gatttggagtctttgaagaagaggcatcagaaggagaaacttaccgtccagaaacaacat
tgcacagcgatagagaagattatcaaagggaaaaacaaagcggagctgtcgagagatccg
atcgttcgtcgagaagtttccgagcaaacggttcaatggtctcgattggcggataagcaa
cgtcgagaggaacgtgacctgatacgttcacatttggaggagcggaggaacactctgaga
aaattgtgtgtggctgctcagttggctcagcagaaacagctgacggcgcggcacgagcgc
gagatcaaagaaatgaacgcgaggcaggcgaggctgtccgtggagagcacgagggaggtg
atgaacgataaaactttgaagacccgggggataaaggagggccggcttagggagaagcag
cagaataatacgaaaaaattcatggaggagaggagaatcgcacaaatgatccagaacagg
gagaaggagaagctgaaagtaatccacgagaagcaattggaggaattgcaaaaagacatg
aatgcggtaatggatatgtacaacaacgaggaaatggagtacgagttgggccctaagacc
gaatgctacgtgtga

DBGET integrated database retrieval system