KEGG   Apis mellifera (honey bee): 408996Help
Entry
408996            CDS       T01057                                 

Gene name
norpA2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ame  Apis mellifera (honey bee)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    408996 (norpA2)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    408996 (norpA2)
   04070 Phosphatidylinositol signaling system
    408996 (norpA2)
 Organismal Systems
  Sensory system
   04745 Phototransduction - fly
    408996 (norpA2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    408996 (norpA2)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     408996 (norpA2)
Membrane trafficking [BR:ame04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    408996 (norpA2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    408996 (norpA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
LG9
AA seq 1109 aa AA seqDB search
MTKRFEFNWQIEVPLALRQGCVFDRWSEEKDNTELELNCVFKVDEYGFFIYWQSEGRDGD
VIELCQVSDIRAGGLPKDPKLYDKLVTKHGEQLEEKCLTICSGVDYTNINYQHVVCPDSA
TAKIWLDGIRSITHNVKANNVCPLTCLKKHWMRLRMLIDPNGKVPVKVVARTFASGKTEK
LVYQCLADLGLSSGKNDVIEPEDFTFDAFYALYHKICPRNDIEELFQSITQGKADTINLD
QLVMFLNEKQRDPTLNEILYPLYDEKRALEIINDYEQNEMARNQKTMTKDGFIRYLMSDE
NAPVFLDRLDVYMDMDQPLAHYYINSSHNTYLCGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDEEPIITHGKAMCTDILFKDVIYAVRDTAFVTSEYPVILSFENHCSKKQQYKL
AKYCDEILGDLLLKEPLKDYPLEPGVPLPSPNLLKRKILIKNKRLKPEVEKHELELFRQG
QFVIEDEVKEDASAPPSVAVVVEQQSVKEEVSTTESVASSTTGNQQQSSSSTGLGETLDI
PVPPYTGSTTNVHPWLSSMVNYAQPIKFPGFDVAELPSCTEKNIHHNMSSFAETAGLNYL
KTQAIEFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQTADLPMQLNQGK
FEYNGSSGYLLKPDFMRRADRSFDPFAESPVDGVIATQCSVQVIAGQFLSDKKVGTYVEV
EMYGLPTDTIRKEFRTRVVPANGLNPVYNEEPFLFRKVVLPDLAALRFAVYDESNGKLLG
QRIVPLDGLQSGYRHISLRTEANFPMSLPMLFCNIEIKIYVPDGYEGLMDALTAPRAYKK
SENASQNKMRGLGIEESDSKGHCDSAPAHHREAPKPREEMKFNPITAESLRQEKGYQKVL
RKQQKDLESLKKRHQKEKLTVQKQHCTAIEKIIKGKNKAELSRDPIVRREVSEQTVQWSR
LADKQRREERDLIRSHLEERRNTLRKLCVAAQLAQQKQLTARHEREIKEMNARQARLSVE
STREVMNDKTLKTRGIKEGRLREKQQNNTKKFMEERRIAQMIQNREKEKLKVIHEKQLEE
LQKDMNAVMDMYNNEEMEYELGPKTECYV
NT seq 3330 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaagattcgagttcaattggcagatcgaggtacccttagccctccgtcaggga
tgcgtgttcgatcgatggtcggaagagaaggacaacacggagctcgagctgaattgcgtg
ttcaaggtcgacgaatatgggttcttcatctactggcagagcgaaggaagggacggggac
gtgatagagctgtgtcaagtgagcgatatacgcgccggcggattaccaaaggacccgaag
ctgtacgacaagcttgtgacaaagcacggggagcaattagaggagaaatgtttaaccatc
tgttcgggcgtagattataccaatattaattaccagcatgtcgtttgcccggattcagct
acggccaagatatggctggatggcatacgatcgattacgcacaacgtgaaagccaacaac
gtttgcccgcttacgtgcttgaagaaacattggatgaggcttagaatgctgatcgatccg
aatggaaaagttccggtgaaagtggtcgcgagaactttcgcatctgggaaaacggaaaag
cttgtttatcagtgcctcgccgatttaggtctatccagcgggaagaacgatgtgatcgag
cctgaagacttcaccttcgacgctttctacgcgttgtaccataaaatctgccctcgaaac
gacatagaggaattgttccaatccatcacccagggcaaagcggacacgatcaatctcgat
caattggtcatgttcctgaacgagaagcaacgagatccaacgttgaacgagatcttgtac
ccgttgtacgacgagaagagggcgttggagataataaacgattacgagcagaacgagatg
gcgaggaatcaaaaaacgatgacgaaggacggtttcataaggtacctgatgtcagacgaa
aatgcccccgtattcctggacaggctggacgtttacatggacatggatcaaccgctcgcg
cattactacatcaactcgagccacaacacgtacctgtgcggccgtcaattcggcgggaag
agcagcgtcgagatgtacaggcaggtgttgttggccggttgcaggtgcgtcgagttggat
tgttgggatggaaaaggggaggacgaggagccgataattacgcatggcaaagctatgtgc
acggacattctcttcaaggacgtgatttacgcggtgagggacacagcgttcgtcacgtcg
gaatatccggtcattcttagcttcgagaaccattgcagcaagaagcagcagtacaaattg
gccaaatactgcgacgaaattctgggcgatctgcttctcaaggaaccgctcaaagactat
ccactggagccaggagtacctctgccgtcgcccaatctgctcaaacgtaagattctgata
aagaacaaacgtttgaaacccgaggtggagaagcacgagttggaattgttccggcaaggc
caattcgtcatcgaggacgaggtcaaggaagacgcgagcgcgcctccctccgtcgctgtt
gtcgttgaacaacaatcggtaaaggaagaggtttcgacgaccgagtcagtcgcatcgtcg
acgaccgggaaccagcaacagtcgagctcgagcacgggattgggcgaaactctggacata
cccgttcctccgtatacaggaagcacgacaaacgtccacccatggttgtcctcgatggtc
aactacgcgcagcccatcaagttcccaggcttcgatgttgccgaactgccctcttgtaca
gaaaagaatattcatcacaatatgtcttccttcgcggaaaccgctggcctcaattacttg
aagacccaagcgatcgagttcgtcaattacaacaagcggcaaatgagccggatttatccg
aaaggaacccgagcggattcatcgaattacatgccacaggtcttctggaacgctggttgt
caaatggtgtcgttgaatttccaaaccgcggacctgcccatgcaactgaatcagggcaag
ttcgagtacaacggctcgtccggctacctactcaaacctgacttcatgagacgtgccgat
cgaagcttcgacccgttcgcggagagccctgtggacggtgtgatcgccacccaatgcagc
gttcaggtgatcgctggtcaatttttatccgacaagaaggtcggcacttacgtggaggtg
gagatgtacggtctaccgacggacacgatcaggaaagaatttcggaccagggttgttcct
gcgaacggcttgaatcccgtttacaacgaggagcctttcctgtttcgaaaagtcgtgctg
ccggatctggccgccctcagattcgctgtttacgacgagtcgaacgggaagctgttgggc
caaaggatcgtcccgttagacggtctacagtcgggatacaggcacatatccctgaggacg
gaggcgaacttccccatgtccttgcccatgctgttctgcaacatagagatcaagatttac
gtgccggacgggtacgaggggctcatggacgcgctcacggcgccacgggcctacaagaag
tcggagaacgcgtctcagaataagatgcgcgggcttgggatagaggagagcgacagcaaa
gggcactgtgactccgcgcccgctcatcatcgggaagcgcctaaacctcgagaggaaatg
aaattcaatccgataacggctgaatcgttgaggcaagagaaggggtatcagaaagtgttg
agaaagcagcagaaggatttggagtctttgaagaagaggcatcagaaggagaaacttacc
gtccagaaacaacattgcacagcgatagagaagattatcaaagggaaaaacaaagcggag
ctgtcgagagatccgatcgttcgtcgagaagtttccgagcaaacggttcaatggtctcga
ttggcggataagcaacgtcgagaggaacgtgacctgatacgttcacatttggaggagcgg
aggaacactctgagaaaattgtgtgtggctgctcagttggctcagcagaaacagctgacg
gcgcggcacgagcgcgagatcaaagaaatgaacgcgaggcaggcgaggctgtccgtggag
agcacgagggaggtgatgaacgataaaactttgaagacccgggggataaaggagggccgg
cttagggagaagcagcagaataatacgaaaaaattcatggaggagaggagaatcgcacaa
atgatccagaacagggagaaggagaagctgaaagtaatccacgagaagcaattggaggaa
ttgcaaaaagacatgaatgcggtaatggatatgtacaacaacgaggaaatggagtacgag
ttgggccctaagaccgaatgctacgtgtga

DBGET integrated database retrieval system