KEGG   Apis mellifera (honey bee): 409111Help
Entry
409111            CDS       T01057                                 

Gene name
GB20129
Definition
serine/threonine-protein kinase minibrain-like
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     409111 (GB20129)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   409111 (GB20129)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
Un
AA seq 586 aa AA seqDB search
MQARIPHRFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRAQQMQGEDGSHKKERKLY
NDGWDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAFDHEEQTQVAIKIIKNKKPF
LNQAQIEVRLLEMMNRADTDNKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRG
VSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQ
RIYQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEV
LGMPPKHILDQAHKARKYFDKVPTDGSYVLKKSKDGKKYKPPGTRRLHDILGVESGGPGG
RRIGEPGHSISDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKRTADEGTNTNIAAANS
ANTSPAVVSMSQDHGLVTMSGQGSNNSGNPMQISSLPGGYQPMECDSSPRHLGNRRVVTT
NYPSTSATGVSASGPMSMQSVDSSLIQSSLGSYNSLILPGISHLPAMMTSPMIQQQNFYN
YGYSTTDAHGIVRQPSTVSTGKQRDPEREDSPMVGVCVQQSPVAIH
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaggataccccataggtttcgtgatccagctacagcacctcttaggaaactt
agtgtagatctcatcaaaacttacaagcacatcaacgaggtttattatgctaagaaaaaa
aggagggcgcaacaaatgcaaggagaagatggttcccataaaaaagaaagaaaattgtac
aacgatggttgggatgatgataatcatgattatattatcaagaatggggaaaagttcctc
gatcgttatgagatcgattcgctaataggtaaaggcagttttggccaagtagtaaaagcg
tttgatcatgaagaacaaacgcaagtggcaataaaaattatcaagaacaaaaaacctttt
ctaaatcaagcgcaaatcgaagtgaggctattggaaatgatgaacagggcggataccgac
aacaaatattatatagttaaactaaaaaggcattttatgtggcgaaatcatttatgtctg
gtattcgaactgttatcatataatctgtatgatctacttagaaatacaaattttcgagga
gtgtcattgaacttaacaaggaagtttgcacagcaactgtgtactgcccttttgttcctg
tctacaccggaattgaacatcattcactgtgatctgaaacctgaaaacatacttttgtgc
aatcccaaacgaagtgcgataaaaatagtagattttggtagttcgtgtcaacttggacaa
agaatatatcagtatattcaatccaggttttatcgatctcctgaagtcttattaggaata
ccttatgaccttgcgatagacatgtggagtctaggatgtattttagttgaaatgcatacg
ggagaacctctatttagtggggccaacgaggtcgatcaaatgaataaaatcgtagaagta
ttaggaatgccaccgaaacatatattggaccaagcgcataaggcgcggaaatactttgac
aaagtccccacggatggctcgtatgtgctgaaaaagtcaaaggatggtaaaaagtacaaa
cctcctggtacaagacgcttacatgatatcttaggtgtcgaaagcggaggccctggtggt
agaaggataggtgaacctggtcattcaatttctgattacctcaaatttaaagacttaatt
ctgcgaatgctggattttgatccaaaaacaagagtgacgccgtattatgcacttcagcac
aatttctttaaacgaacagccgatgaggggaccaacacgaatattgctgctgccaatagt
gctaacacgagcccggcagtagtatcgatgagccaagatcatggactggtaaccatgtca
ggacagggaagcaacaacagtggcaatccgatgcaaatatcaagtctccctggtggctat
cagcctatggagtgcgattcatcgcctcgtcatttagggaatcgacgtgtcgtaacaaca
aactatccgtcaacttcggccactggggtgtctgcatccgggccgatgtccatgcaatct
gtagacagttccctgatacaaagctctcttggatcgtataatagcctaattctccctggt
atatcccatctgcctgcgatgatgacctcaccaatgattcagcagcagaacttttacaat
tatggttattcaacgactgatgcgcacggaatagtcagacaaccgtcgacagtctcaacc
ggtaaacaaagagatccggaaagagaagatagtcctatggttggagtatgcgtccagcag
agtccagttgctattcactga

DBGET integrated database retrieval system