KEGG   Apis mellifera (honey bee): 409150Help
Entry
409150            CDS       T01057                                 

Gene name
Echs1, GB18498
Definition
enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ame  Apis mellifera (honey bee)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    409150 (Echs1)
   01212 Fatty acid metabolism
    409150 (Echs1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    409150 (Echs1)
   00650 Butanoate metabolism
    409150 (Echs1)
  Lipid metabolism
   00062 Fatty acid elongation
    409150 (Echs1)
   00071 Fatty acid degradation
    409150 (Echs1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    409150 (Echs1)
   00310 Lysine degradation
    409150 (Echs1)
   00380 Tryptophan metabolism
    409150 (Echs1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    409150 (Echs1)
Enzymes [BR:ame01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     409150 (Echs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG8
AA seq 295 aa AA seqDB search
MTILRIGKILFVKQVQIGRKPQYFASDTKYYCSYVPQNYEFIKVETAGEKKNIGLITLNR
PKALNALCEKLITELNDAMLKFDTNNNIGAIIITGSEKAFAAGADIKEMKNNTFAYNIRN
KFLNNWNISEISKPVIAAVNGYALGGGCELAMMCDIIYAGDTAKFGQPEITIGTIPGAGG
TQRLTRIIGKSKAMEMVLTGKQINAEEAEKNGLVSKIFPANKLIAEAIKLGEKIASHSQL
IVAMAKESVNIAYETTLKEGLHFEKNIFHGTFATDDRKEGMTAFIEKRSPKFNNQ
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacaattctacgcattggaaaaattttatttgtcaaacaagtgcagattggtcgaaaa
ccacagtattttgcatccgatacgaaatattattgttcctatgttccacaaaattatgaa
ttcattaaagtggaaactgctggagaaaaaaaaaatattggtttgattactttaaacaga
ccaaaagctttaaatgctctttgtgaaaaattgataactgaattaaatgatgctatgtta
aaatttgatactaataataatatcggagctataataattacaggcagtgaaaaagcattt
gcagctggtgctgacattaaggaaatgaagaacaatacttttgcatataatattagaaat
aaatttcttaataattggaacatttctgaaatatcaaaaccagtaattgctgctgtaaat
ggatatgctttaggtggaggttgtgaattagcaatgatgtgtgatattatttatgctgga
gatacagcaaagtttggtcaacctgaaatcactattggtaccatacctggtgcaggtggt
actcaaagattaactagaataattggcaagagtaaagcaatggaaatggtattaacaggc
aaacaaatcaacgctgaagaagcagaaaaaaatggtttggttagtaaaatttttccagca
aacaagcttattgctgaagcaattaaattgggtgagaaaattgcttctcattctcaatta
attgttgctatggcaaaagaatctgttaatattgcttatgaaactactttaaaagaagga
cttcattttgaaaaaaatatattccatggtacatttgcaacggatgatagaaaggaaggg
atgacagcattcattgagaaaagatcacctaaattcaataatcaataa

DBGET integrated database retrieval system