KEGG   Apis mellifera (honey bee): 409155Help
Entry
409155            CDS       T01057                                 

Gene name
GB13073
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ame  Apis mellifera (honey bee)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    409155 (GB13073)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    409155 (GB13073)
  Amino acid metabolism
   00310 Lysine degradation
    409155 (GB13073)
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     409155 (GB13073)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG5
AA seq 438 aa AA seqDB search
MKEVVVPPFAESVSEGDVRWDKKIGDLVKEDDVLCEIETDKTSVPVPAPGSGVIKEIFAK
DGQTVKSGQKLCVIDIGATDGAPAASKVVEKVPSPPPSTTAAAAAPPPPPPPPPPPSPPP
PPPPPPPPPPPPPPSPLSPSLSPLSTSSSLPPTPSPAIVPPPAARPPSPQGPAVSIPVTT
IKPAQALEAAKVQLPPDDYTREITGTRTEQRVKMNRMRMRIAERLKEAQNTNAMLTTFNE
IDMSRIMEFRKLHQENFTKKYGLKLGFMSPFIAASAYALKDQPVVNAVIDGAEIVYRDYV
DISVAVATPKGLVVPVLRSVENKNFAEIEIALAALSDKARKGKITVEDMDGGTFTISNGG
VFGSLMGTPIINPPQSSILGMHGVFDRPIAIKGEIVIRPMMYVALTYDHRLIDGREAVMF
LRKIKAAVEDPRIILAGL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagttgtagtaccaccatttgcagaaagtgtaagtgaaggagatgttaggtgg
gataaaaaaattggtgatctggttaaagaagatgatgttttatgtgaaattgaaacagat
aagacttcagttcctgtaccagcaccaggttctggtgtaataaaagagatttttgccaaa
gatggtcaaacagtaaaatcagggcagaaactatgtgttattgacattggtgctactgat
ggagcaccggcagcatctaaagttgttgaaaaagttccaagtcctccacctagcacaaca
gcagcagcagcagcaccaccaccaccaccaccacctcctccaccaccatcaccaccacca
ccaccaccaccaccaccaccaccaccaccaccaccaccaccatcaccactatcaccatca
ctatcaccactatccacatcatcatcattaccaccaacaccttctcctgcaattgtacca
cctccagcagctcgaccgccatctccgcaaggacctgcagtatctataccagttactaca
attaaacctgctcaagcattagaagctgcaaaagtacaattacctcctgatgattataca
cgtgaaataactggtaccagaacagaacaacgggtaaaaatgaacagaatgcgaatgcgt
attgcagaacgattaaaagaagctcaaaatacgaatgctatgttaacaacatttaatgaa
attgatatgagtcgtattatggaattccgcaaattacatcaagaaaactttacaaagaaa
tatggtttgaaattaggatttatgagtccatttattgcagcaagtgcctatgctttaaaa
gatcaaccagtagtaaatgctgtaatagacggcgctgaaatagtttatagagattatgtt
gatatcagtgttgcagttgcaacaccaaaaggacttgttgtcccagttcttcgtagtgta
gaaaataaaaattttgcagaaattgaaattgctttggcagctttaagcgataaagcaaga
aaaggtaaaataactgtcgaagatatggatggtggtacatttacaataagtaacggcggt
gtttttggttctctgatgggaacgcctattattaatccaccacaaagctcaattcttgga
atgcacggagtatttgatagacccattgcaataaagggcgagatcgtaattcgtccaatg
atgtatgtggctttaacatatgatcatcgattaattgatggacgtgaggctgtgatgttt
ttaagaaagatcaaggctgctgtagaagatcccagaattatattagctggactttga

DBGET integrated database retrieval system