KEGG   Apis mellifera (honey bee): 409155Help
Entry
409155            CDS       T01057                                 

Gene name
GB13073
Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ame  Apis mellifera (honey bee)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    409155 (GB13073)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    409155 (GB13073)
  Amino acid metabolism
   00310 Lysine degradation
    409155 (GB13073)
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     409155 (GB13073)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG5
AA seq 438 aa AA seqDB search
MKEVVVPPFAESVSEGDVRWDKKIGDLVKEDDVLCEIETDKTSVPVPAPGSGVIKEIFAK
DGQTVKSGQKLCVIDIGATDGAPAASKVVEKVPSPPPSTTAAAAAPPPPPPPPPPPSPPP
PPPPPPPPPPPPPPSPLSPSLSPLSTSSSLPPTPSPAIVPPPAARPPSPQGPAVSIPVTT
IKPAQALEAAKVQLPPDDYTREITGTRTEQRVKMNRMRMRIAERLKEAQNTNAMLTTFNE
IDMSRIMEFRKLHQENFTKKYGLKLGFMSPFIAASAYALKDQPVVNAVIDGAEIVYRDYV
DISVAVATPKGLVVPVLRSVENKNFAEIEIALAALSDKARKGKITVEDMDGGTFTISNGG
VFGSLMGTPIINPPQSSILGMHGVFDRPIAIKGEIVIRPMMYVALTYDHRLIDGREAVMF
LRKIKAAVEDPRIILAGL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagttgtagtaccaccatttgcagaaagtgtaagtgaaggagatgttaggtgg
gataaaaaaattggtgatctggttaaagaagatgatgttttatgtgaaattgaaacagat
aagacttcagttcctgtaccagcaccaggttctggtgtaataaaagagatttttgccaaa
gatggtcaaacagtaaaatcagggcagaaactatgtgttattgacattggtgctactgat
ggagcaccggcagcatctaaagttgttgaaaaagttccaagtcctccacctagcacaaca
gcagcagcagcagcaccaccaccaccaccaccacctcctccaccaccatcaccaccacca
ccaccaccaccaccaccaccaccaccaccaccaccaccaccatcaccactatcaccatca
ctatcaccactatccacatcatcatcattaccaccaacaccttctcctgcaattgtacca
cctccagcagctcgaccgccatctccgcaaggacctgcagtatctataccagttactaca
attaaacctgctcaagcattagaagctgcaaaagtacaattacctcctgatgattataca
cgtgaaataactggtaccagaacagaacaacgggtaaaaatgaacagaatgcgaatgcgt
attgcagaacgattaaaagaagctcaaaatacgaatgctatgttaacaacatttaatgaa
attgatatgagtcgtattatggaattccgcaaattacatcaagaaaactttacaaagaaa
tatggtttgaaattaggatttatgagtccatttattgcagcaagtgcctatgctttaaaa
gatcaaccagtagtaaatgctgtaatagacggcgctgaaatagtttatagagattatgtt
gatatcagtgttgcagttgcaacaccaaaaggacttgttgtcccagttcttcgtagtgta
gaaaataaaaattttgcagaaattgaaattgctttggcagctttaagcgataaagcaaga
aaaggtaaaataactgtcgaagatatggatggtggtacatttacaataagtaacggcggt
gtttttggttctctgatgggaacgcctattattaatccaccacaaagctcaattcttgga
atgcacggagtatttgatagacccattgcaataaagggcgagatcgtaattcgtccaatg
atgtatgtggctttaacatatgatcatcgattaattgatggacgtgaggctgtgatgttt
ttaagaaagatcaaggctgctgtagaagatcccagaattatattagctggactttga

DBGET integrated database retrieval system