KEGG   Apis mellifera (honey bee): 409169Help
Entry
409169            CDS       T01057                                 

Definition
(RefSeq) mRNA export factor
  KO
K14298  
mRNA export factor
Organism
ame  Apis mellifera (honey bee)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    409169
Messenger RNA biogenesis [BR:ame03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     409169
Chromosome [BR:ame03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    409169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG8
AA seq 355 aa AA seqDB search
MFNQSGGLQTGTSSTSNPMQDFEVVSPPDDSVSSLAFSPASIPQNFLVAGSWDCNVRCWE
VEQSGKTVPKSMQSMAAPVLDVCWSDDGTKVFMASCDKTAKCWDLASNQAIQVAAHDAPI
KTCHWIKASTYSCLMTGSWDKTLRFWDLRSPKPAMTINLIERCYCADVDYPMAVVGTAGR
GLIVYQLEGSPREYKTVELSLKYQYRCVAIFKDKKKVPTGFAIGSTEGRVAIHHLNLSSK
ENFTFKCHRTNGTPNGYQDIYAVNDIAFHPVHGTVATVGGDGTFGFWDKDARTKLKSSEP
MEQPITRCCFNHNGQIFAYAVSYDWSKGHEYYNPAKKNSIFLRPCFEELKPKASP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatcaaagtggaggattacaaactggcacatcatctacttctaatccaatgcaa
gattttgaggttgtctctcctcctgatgattctgtttccagtctcgcatttagtcctgct
tctattccacaaaattttcttgttgctggttcttgggattgcaatgttcgttgctgggaa
gttgaacaatccggcaaaacggttcctaaatcgatgcaatccatggcagccccagttctc
gatgtttgttggagcgatgatggaacaaaagtattcatggcatcttgtgacaaaactgca
aaatgttgggacttagcttcaaaccaggctattcaagttgcagcacatgatgcacctatt
aaaacttgtcattggattaaagcaagtacatattcatgtcttatgacaggttcttgggat
aaaacattaagattttgggatctacgaagtcctaaaccagcaatgactataaatttaatt
gaaagatgttactgtgcagatgttgattatccaatggcagtagtaggaactgctggacgt
ggattaatagtttatcagttggaaggtagtcctcgagaatataagacagtagaattaagt
ctaaaatatcaatatcgatgtgttgcaatttttaaagataaaaaaaaagttcccactggt
tttgcaattggcagtacagaaggtcgtgtagcaatacatcatttgaatttaagttcaaaa
gaaaattttacttttaaatgtcacagaacaaatggaactcctaatggatatcaagatatt
tatgcagtaaatgatattgcatttcatccagttcatggtactgttgcaactgttggaggt
gatggtacatttggattttgggacaaagatgcaagaactaaattaaaatcttcagaacct
atggagcaaccaattactcggtgttgcttcaatcacaatgggcaaatatttgcatatgca
gtatcatatgattggtcaaaaggccatgaatattataatccagctaaaaaaaattccata
ttccttagaccatgttttgaagaactaaaacctaaagcgtcaccgtaa

DBGET integrated database retrieval system