KEGG   Apis mellifera (honey bee): 409169Help
Entry
409169            CDS       T01057                                 

Gene name
GB12111
Definition
mRNA export factor-like
Orthology
K14298  
mRNA export factor
Organism
ame  Apis mellifera (honey bee)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    409169 (GB12111)
Messenger RNA biogenesis [BR:ame03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     409169 (GB12111)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG8
AA seq 355 aa AA seqDB search
MFNQSGGLQTGTSSTSNPMQDFEVVSPPDDSVSSLAFSPASIPQNFLVAGSWDCNVRCWE
VEQSGKTVPKSMQSMAAPVLDVCWSDDGTKVFMASCDKTAKCWDLASNQAIQVAAHDAPI
KTCHWIKASTYSCLMTGSWDKTLRFWDLRSPKPAMTINLIERCYCADVDYPMAVVGTAGR
GLIVYQLEGSPREYKTVELSLKYQYRCVAIFKDKKKVPTGFAIGSTEGRVAIHHLNLSSK
ENFTFKCHRTNGTPNGYQDIYAVNDIAFHPVHGTVATVGGDGTFGFWDKDARTKLKSSEP
MEQPITRCCFNHNGQIFAYAVSYDWSKGHEYYNPAKKNSIFLRPCFEELKPKASP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatcaaagtggaggattacaaactggcacatcatctacttctaatccaatgcaa
gattttgaggttgtctctcctcctgatgattctgtttccagtctcgcatttagtcctgct
tctattccacaaaattttcttgttgctggttcttgggattgcaatgttcgttgctgggaa
gttgaacaatccggcaaaacggttcctaaatcgatgcaatccatggcagccccagttctc
gatgtttgttggagcgatgatggaacaaaagtattcatggcatcttgtgacaaaactgca
aaatgttgggacttagcttcaaaccaggctattcaagttgcagcacatgatgcacctatt
aaaacttgtcattggattaaagcaagtacatattcatgtcttatgacaggttcttgggat
aaaacattaagattttgggatctacgaagtcctaaaccagcaatgactataaatttaatt
gaaagatgttactgtgcagatgttgattatccaatggcagtagtaggaactgctggacgt
ggattaatagtttatcagttggaaggtagtcctcgagaatataagacagtagaattaagt
ctaaaatatcaatatcgatgtgttgcaatttttaaagataaaaaaaaagttcccactggt
tttgcaattggcagtacagaaggtcgtgtagcaatacatcatttgaatttaagttcaaaa
gaaaattttacttttaaatgtcacagaacaaatggaactcctaatggatatcaagatatt
tatgcagtaaatgatattgcatttcatccagttcatggtactgttgcaactgttggaggt
gatggtacatttggattttgggacaaagatgcaagaactaaattaaaatcttcagaacct
atggagcaaccaattactcggtgttgcttcaatcacaatgggcaaatatttgcatatgca
gtatcatatgattggtcaaaaggccatgaatattataatccagctaaaaaaaattccata
ttccttagaccatgttttgaagaactaaaacctaaagcgtcaccgtaa

DBGET integrated database retrieval system