KEGG   Apis mellifera (honey bee): 409196Help
Entry
409196            CDS       T01057                                 

Gene name
GB17641
Definition
alanine aminotransferase 2-like
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
ame  Apis mellifera (honey bee)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    409196 (GB17641)
   01210 2-Oxocarboxylic acid metabolism
    409196 (GB17641)
   01230 Biosynthesis of amino acids
    409196 (GB17641)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    409196 (GB17641)
Enzymes [BR:ame01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     409196 (GB17641)
Amino acid related enzymes [BR:ame01007]
 Aminotransferase (transaminase)
  Class I
   409196 (GB17641)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG8
AA seq 543 aa AA seqDB search
MPQARWWNAVIASSRPRTWEQLTASSSAGSGTSTGRTSICPTTEVVIHRPATVRTLHRGM
ASSQSGTKILTEDNVFTNLRKMEYAVRGPLLLRALEIEKELQKGVKKPFKEVIKANVGDA
HAMGQQPITFLRQVLTLTVSPNLLNDPNYPEDVKDRAKTILYHCKGGSIGSYSESAGIEI
IRKHIAQYIQDRDGIPSDYHNIILSNGASDGIKSFLKLFNEKIDGKPSGVMIPIPQYPLY
SATLAEFGLAQIGYYLNEENKWALDISELDRALNESRRMCNPRVLVVINPGNPTGQVLTR
TNIEDIIRFAYKNHLFLLADEVYQDNVYDKDSAFHSFKKVMTEMGEPYCKMELASFMSIS
KGYMGECGIRGGYGEIINMDPKVMAILLKSISAMLCPTVLGQVVMDVVVNPPKSNEPSYE
LFQKEKEQTLYSLAERSKLVVDTLNTIPGFKVNPAMGAMYVFPRIDLPKKAIEVAEREGQ
QPDVFYAFKLLESTGICVIPGSGFGQQPGTYHFRTTILPQKEKIKTMLECLKQFHLKFLE
EYK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaggcacgctggtggaacgctgttatcgcgagcagtcggcctaggacgtgggaa
caactgactgcctcctcctccgcgggttcagggacatcgacaggaagaacatccatatgt
ccgacgactgaagttgtaatccaccggccggctaccgtcagaacattacaccgcggcatg
gcgagcagtcaatctggaaccaaaatcctcaccgaggataatgttttcacgaatcttcgg
aaaatggagtacgcagtgcgcggaccactccttttacgtgctctcgagatcgaaaaggag
cttcagaagggagtcaagaaaccattcaaggaggtgataaaggcaaatgtgggagatgca
catgctatgggccaacagcctatcactttcttgaggcaagtactgaccctgacagtatcg
ccgaatcttctcaatgatcctaactatcctgaagacgtgaaggatcgagccaagactatc
ttataccattgtaaaggaggcagcattggttcgtattcggaatcagcaggaattgagatc
atccggaaacatattgcccagtacattcaggatcgcgatggaattccatctgattatcat
aatatcatcctctcgaacggcgcttcggatggaattaaatcctttctgaagttgttcaat
gagaaaatagacggtaaaccatccggtgtgatgattccaattccacagtatcctttatat
tctgccactctagctgaatttggtttggctcaaattggttattatttaaatgaagaaaat
aaatgggcgttagatatttctgaattggatagagcattaaatgaatcaagaagaatgtgt
aatcctcgtgtactagtcgtaataaatcctggtaatccaaccggacaagttcttacacgt
accaatattgaagacattattcgatttgcgtataaaaatcatttgttcttgttggctgac
gaggtttatcaagataatgtttatgataaagatagtgccttccattcatttaagaaagta
atgacagaaatgggagaaccttattgtaaaatggaactggcttcctttatgtctatttct
aaaggttatatgggagaatgtggaatccgcggtggctatggagaaattattaatatggat
cccaaagtaatggcaatattattaaagtcgatttcagcaatgttatgtccgactgttctt
ggtcaagtagtgatggacgttgtagtaaatccaccaaaatcaaatgaaccatcctatgaa
ttatttcaaaaagaaaaagaacaaactttatattctttagcggagcgatcgaaattagta
gtcgatacattaaataccattccaggttttaaggttaatccagctatgggtgcaatgtat
gtatttccacgaattgatctaccaaaaaaagctatagaggtagcagaaagggaaggtcaa
cagcctgatgttttttatgctttcaaactattagaatctactggaatatgtgtaatacca
ggttctggttttggacaacaacctggaacctatcattttaggacgacaattttgccacaa
aaagaaaaaataaaaacaatgcttgaatgtctgaaacaattccatcttaagttccttgag
gagtacaaataa

DBGET integrated database retrieval system