KEGG   Apis mellifera (honey bee): 409199Help
Entry
409199            CDS       T01057                                 

Gene name
GB15200
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ame00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG14
AA seq 548 aa AA seqDB search
MNKNESTSRYGPLVGAIDEGTSSARFLVFAADTAEVLTYHQVPITQTCPKEGWVEQDPIE
ILKAVRECLNQTIFNLRQLTIDPTDIVAVGITNQRETTVVWDSITGEPLYNAIVWMDMRT
TSIVDDILKKIRNQNKNYLKPLCGLPISPYFSGLKLKWLLENVPRVREALDLKRCMFGTI
DSWLIWNLTGGVHATDVTNASRTMLMNITTLKWDPTLLSFFNIPPEILPEIRSSSEIYGY
IQDEVLSGVPISGCLGDQQSALVGQMCLQKGQAKSTYGTGCFLLYNTGTAIVDSSHGLLT
TVAYQLGPQAAPIYALEGSVAIAGAVIQWLKDNLGVLSDVKESESLVEQIPTDNRVTFVP
AFAGLYAPYWRKDARSVICGITEDTNSTHIIKAALQAVCFQTRDILEAMKEDTGLTLSKL
LVDGAMTTNNLLMQMQADICGIPVVRPLMCETTALGVAIAAGNADGIRKWDVKLDIAVPS
DIFLPSISENERDILYSQWKMAIDRSLGWEPVSNTNDNIKNIHKATAPGIFMISTLLLLM
IAKYHSML
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaatgagtcgacaagtagatatggacccctcgtcggtgcaatcgacgaaggg
acaagtagtgctagatttttggtttttgctgcagatacagctgaagtattaacatatcat
caggttccaataacacaaacatgtccaaaagaaggatgggttgaacaagatcctatagaa
atattaaaagcagttagagaatgtcttaatcagactatatttaatttacgtcagcttacc
atagatcccactgatatagttgcagttggtataacaaaccaaagagaaactacagttgta
tgggattccattactggagaaccattatataatgctatagtatggatggatatgagaact
acttcaattgtagatgatatattaaaaaaaatacgtaatcaaaataaaaactatttaaaa
ccactttgtggtttaccaattagtccatatttcagtggtttaaaattaaaatggttatta
gaaaatgtacctcgtgtacgtgaggctctagatttaaaacgatgtatgtttggtacaatt
gattcatggttaatttggaatttaactggaggtgttcatgccactgatgttacaaatgct
tcaagaacaatgttaatgaatatcacaactttaaaatgggatccaacattattatcattt
tttaatatacctcctgaaattttaccagagattcgtagttcatcagaaatatatggttat
atacaagatgaagttttatctggtgtaccaatatcaggatgtttaggtgatcaacagtca
gcattagtaggacaaatgtgtttacaaaaaggacaagcaaaaagcacttatggcacaggc
tgttttcttttatataatactggaactgctattgtagattcatctcatggattattgaca
acagttgcttatcaattaggaccacaagcagcaccaatatatgctcttgaaggctctgta
gctatagctggtgctgttattcaatggctaaaagataatcttggagtattatctgatgta
aaggaatctgaatctcttgttgaacaaattccaactgataatcgtgttacatttgtacct
gcatttgctggattatatgctccatattggaggaaagatgcaagaagcgttatatgtgga
attactgaagatacaaatagtacacatattataaaggcagctttgcaagctgtttgtttt
cagacaagagacattttggaagctatgaaagaagacacaggtttaacattatctaaattg
ttagtagatggtgctatgactactaataatttgttaatgcaaatgcaagcagatatttgt
ggaattccagttgtgaggcctttaatgtgtgaaactactgcacttggagttgcaattgct
gcaggaaatgcagatggtatacgaaaatgggatgtaaaacttgatattgctgtaccaagt
gatatctttttaccttcaatatctgagaatgaacgagatatattatattcacaatggaaa
atggctattgatcgtagtttaggttgggaaccagtttctaataccaatgataatataaag
aatattcacaaagcaactgctccaggtatttttatgataagtacattacttttacttatg
attgcaaaatatcattctatgttatga

DBGET integrated database retrieval system