KEGG   Apis mellifera (honey bee): 409201Help
Entry
409201            CDS       T01057                                 

Gene name
GB13556
Definition
acyl-protein thioesterase 1-like
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ame00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG10
AA seq 219 aa AA seqDB search
MTTVSPVVIAATARHTATLIFFHGLGDTGHGWASSMGAVRSPHIKVICPTASTMPVTLNA
GFRMPSWFDLRSLEPSGPEDEEGIRRAAEMVHSLIAEEVAAGIPTKRIVLGGFSQGGALA
IYSALTFPEPLAGIIALSAWLPLHQKFPAEAIGNKNTPLLQCHGDCDPIVPYRWGQLTAS
VLKQFMTQTEFKTYRGMMHASCDEEMRDMKKFIEKVLKP
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagtgagtcctgtggtaatagcagctacagccagacatacagcaacacttata
tttttccatggattgggtgatacaggtcatggttgggctagttctatgggagcagtaaga
tctcctcatattaaagttatttgtccaactgcatctacaatgccagtgacattaaatgca
ggatttagaatgccttcttggtttgatttacgatctttggaaccaagtggtcctgaagat
gaagaaggtattcgtagagctgcagaaatggtacattctttaattgcagaagaagttgca
gcaggaatacccacaaaacgtattgttcttggaggttttagtcagggtggtgctcttgct
atatatagtgctcttacatttccagaacctttagctggtattatagctttatcagcttgg
cttcctttacatcaaaaatttccagctgaagcaataggaaataaaaatactccattgctt
caatgtcatggtgattgtgatccaatagtgccatatagatggggtcaattgactgcatca
gttcttaaacaatttatgacacaaacagaattcaaaacatatagaggaatgatgcatgca
tcttgtgatgaggaaatgcgtgatatgaagaaattcattgaaaaagttttgaagccgtaa

DBGET integrated database retrieval system