KEGG   Apis mellifera (honey bee): 409201Help
Entry
409201            CDS       T01057                                 

Definition
(RefSeq) acyl-protein thioesterase 1
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    409201
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     409201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 DLH Abhydrolase_6 Abhydrolase_1 Abhydrolase_3 FSH1 Peptidase_S9 DUF2974 Esterase Cutinase Lipase_3 Esterase_phd
Motif
Other DBs
NCBI-GeneID: 409201
NCBI-ProteinID: XP_392725
BEEBASE: GB50980
UniProt: A0A088AHK0
Position
LG10
AA seq 219 aa AA seqDB search
MTTVSPVVIAATARHTATLIFFHGLGDTGHGWASSMGAVRSPHIKVICPTASTMPVTLNA
GFRMPSWFDLRSLEPSGPEDEEGIRRAAEMVHSLIAEEVAAGIPTKRIVLGGFSQGGALA
IYSALTFPEPLAGIIALSAWLPLHQKFPAEAIGNKNTPLLQCHGDCDPIVPYRWGQLTAS
VLKQFMTQTEFKTYRGMMHASCDEEMRDMKKFIEKVLKP
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagtgagtcctgtggtaatagcagctacagccagacatacagcaacacttata
tttttccatggattgggtgatacaggtcatggttgggctagttctatgggagcagtaaga
tctcctcatattaaagttatttgtccaactgcatctacaatgccagtgacattaaatgca
ggatttagaatgccttcttggtttgatttacgatctttggaaccaagtggtcctgaagat
gaagaaggtattcgtagagctgcagaaatggtacattctttaattgcagaagaagttgca
gcaggaatacccacaaaacgtattgttcttggaggttttagtcagggtggtgctcttgct
atatatagtgctcttacatttccagaacctttagctggtattatagctttatcagcttgg
cttcctttacatcaaaaatttccagctgaagcaataggaaataaaaatactccattgctt
caatgtcatggtgattgtgatccaatagtgccatatagatggggtcaattgactgcatca
gttcttaaacaatttatgacacaaacagaattcaaaacatatagaggaatgatgcatgca
tcttgtgatgaggaaatgcgtgatatgaagaaattcattgaaaaagttttgaagccgtaa

DBGET integrated database retrieval system