KEGG   Apis mellifera (honey bee): 409201Help
Entry
409201            CDS       T01057                                 

Gene name
GB13556
Definition
acyl-protein thioesterase 1-like
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    409201 (GB13556)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     409201 (GB13556)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG10
AA seq 219 aa AA seqDB search
MTTVSPVVIAATARHTATLIFFHGLGDTGHGWASSMGAVRSPHIKVICPTASTMPVTLNA
GFRMPSWFDLRSLEPSGPEDEEGIRRAAEMVHSLIAEEVAAGIPTKRIVLGGFSQGGALA
IYSALTFPEPLAGIIALSAWLPLHQKFPAEAIGNKNTPLLQCHGDCDPIVPYRWGQLTAS
VLKQFMTQTEFKTYRGMMHASCDEEMRDMKKFIEKVLKP
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagtgagtcctgtggtaatagcagctacagccagacatacagcaacacttata
tttttccatggattgggtgatacaggtcatggttgggctagttctatgggagcagtaaga
tctcctcatattaaagttatttgtccaactgcatctacaatgccagtgacattaaatgca
ggatttagaatgccttcttggtttgatttacgatctttggaaccaagtggtcctgaagat
gaagaaggtattcgtagagctgcagaaatggtacattctttaattgcagaagaagttgca
gcaggaatacccacaaaacgtattgttcttggaggttttagtcagggtggtgctcttgct
atatatagtgctcttacatttccagaacctttagctggtattatagctttatcagcttgg
cttcctttacatcaaaaatttccagctgaagcaataggaaataaaaatactccattgctt
caatgtcatggtgattgtgatccaatagtgccatatagatggggtcaattgactgcatca
gttcttaaacaatttatgacacaaacagaattcaaaacatatagaggaatgatgcatgca
tcttgtgatgaggaaatgcgtgatatgaagaaattcattgaaaaagttttgaagccgtaa

DBGET integrated database retrieval system