KEGG   Apis mellifera (honey bee): 409261Help
Entry
409261            CDS       T01057                                 

Gene name
GB18572
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    409261 (GB18572)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     409261 (GB18572)
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   409261 (GB18572)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 616 aa AA seqDB search
MIMEEEKAEAVAKNGDPDVKEETEEDEDGMFDESSFPELERTQTGRKTSIFKYYSFKEKD
IMPSSIKKPGPLIGVIDVGTRTVRFVVFNAKHVAEVASHQIDIEQISPQEGWMEQDPKEI
LFAVKACIKDVIRKLDVLGLKMDEIVTIGITNQRETTVAWDAMTGEPLYNAIVWSDIRTS
SIVDQIIAKFPDQSKNHIKPLCGLPVSPYFSALKIRWMKDNVPTVRKAMRDRRCKVGTMD
TWIVWNLTGGKDGGLYITDVTNASRTMLMNIETLSWDPTLCRYFDIPMQMLPEIRSSAEI
YGKIAIGPLKGITISGILGNQQSALVGQNCLKKGQAKNTYRSGCFLLCNTGTTRVYSSHG
LVTTVAYQLGPKSSAVYALEGSIAVAGAAIKWLRDNMKLIKDVHESEHLAQSVFSTGDVY
FVPAFTGLYAPYWRKDARGIICGLTAFTTKQHIIRASLEAVCFQTRDILEAMYKDCGFPL
TKLNTDGKMSTNNLLMQLQADLCGTPVFRSTMPDITALGAAMAAGHAEGVDIWELEGEEI
ETVSTDTFLPTTTPEERDARYKKWKMAVERSLGWAAVKKSDQMTDERYYVLASIPASWFL
MTSFILLRLSYYLKNR
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgataatggaagaagagaaggcggaagcagttgcaaagaatggagatccagatgtgaaa
gaagaaactgaagaagacgaagatggaatgtttgatgaatccagttttccggagctggag
cgcacgcaaaccggtcgcaaaacaagtatcttcaagtactattcatttaaagagaaagat
ataatgccaagttcaataaaaaaaccaggtcctcttattggagtaattgatgttggcacg
cgaactgttcgctttgtggtattcaatgcgaagcatgtagctgaagtggcatctcatcaa
atcgacatagaacaaataagtccgcaagaaggatggatggaacaggatcccaaagaaatt
ctttttgcggtaaaagcttgcatcaaagatgttatacggaaattagacgtgttaggttta
aaaatggacgaaatagtaacaattggtattacgaatcaaagagaaactactgtagcatgg
gatgcgatgactggtgaaccattatacaatgcaatagtatggtctgatattagaacgagt
tcgattgttgatcaaataatagctaaatttccggatcaaagtaagaatcatatcaaacct
ttatgcggtttgccagtgagtccatatttttcagcattaaaaatacgttggatgaaagat
aatgtgcccactgttagaaaagcgatgcgagataggcgatgtaaagtgggtacgatggac
acttggatcgtttggaatttaacgggtggcaaagacggtggattatatattactgacgta
acaaacgcgtcaaggaccatgttaatgaacatagaaactctttcatgggatcccacgttg
tgcagatattttgatattcctatgcaaatgttgccagaaattagaagcagtgctgaaatt
tatggaaaaattgcaatcggtccattaaagggtatcactatatctggcattttagggaat
cagcaatcagctttagttggacaaaattgtttaaagaaaggacaagcaaaaaacacatat
agaagtggatgttttttactctgtaatacgggaacaacacgagtatattcttctcatgga
ttagtgacaacggtagcttatcaattaggtccaaaaagttcagctgtttatgcattagaa
ggttcaattgcagtagcaggtgcagctattaaatggttacgagataatatgaaacttata
aaggatgtacatgaaagtgaacatttagcacaaagtgtttttagtactggcgacgtatat
tttgtgccagcttttacaggattatatgctccatattggagaaaagatgcaagaggaatt
atttgtggacttactgcatttacaacaaaacagcatataataagagcatcattagaagct
gtctgttttcaaactagagatattttagaagctatgtataaagattgtggttttccatta
accaaattaaatacagatggaaaaatgtcaacaaataatcttcttatgcaattgcaagca
gatctttgtggtacaccagtatttaggtccacaatgccagatattacagctttaggcgcg
gcaatggcagcaggtcatgcagaaggtgtggatatttgggaattagaaggtgaagaaata
gaaacagtatcgactgatacatttttgccaacaacaacaccagaagaaagagatgccaga
tataaaaaatggaagatggcagttgaaagaagtttaggttgggcagcagtaaagaaatct
gatcaaatgacagacgaaagatattatgtactggcgtcgattcctgcaagttggttctta
atgacaagttttattttattacgattaagttattatttgaaaaatcggtga

DBGET integrated database retrieval system