KEGG   Apis mellifera (honey bee): 409263Help
Entry
409263            CDS       T01057                                 

Gene name
GB18554
Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
ame  Apis mellifera (honey bee)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    409263 (GB18554)
Enzymes [BR:ame01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     409263 (GB18554)
Glycosyltransferases [BR:ame01003]
 Glycan extension
  Type 3 chain
   409263 (GB18554)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG6
AA seq 372 aa AA seqDB search
MIKIILNFYSCLQKFIGIRNGKHFILTLLTGIIFGFISACLLITSTRNVPYMFNWFSGGF
MLSRDPHHYSELESEVGPEIEVKFHSADEDFHKDEDKVAQELAKKVRVLCWIMTGPKNHQ
SKAQHVKATWGKRCNILLFMSSAEDTNLPTVVLSVKEGRDNLWAKTKEAFKYAYEKYKDK
VDWFMKADDDTYVVVENLRYMLSSYDSNSPLYFGCRFKPFVKQGYMSGGAGYVLSKEALR
KFVEEALPNKTKCRSDNGGAEDVEMGKCLEKVNVKAMDTRDPHGRGRFFPFVPEHHLIPN
HMDKNFWYWKYIYYDTKDGLNCCSDSAISFHYVSPNMMYVLEYLIYHLRPYGITHSIEKL
TTDQSITVLTEY
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaataattttaaatttttattcatgtctacaaaaatttataggtattagaaat
ggtaagcattttatattaactcttcttactggtataatttttggatttatctcagcgtgc
cttttaataacttctacaagaaatgtgccatatatgtttaattggttttctggtggtttt
atgctttcaagagatccacatcactattcagaattggaatcagaagttggtcctgaaata
gaggtaaaatttcatagtgcagatgaggattttcataaagatgaagataaagttgcacaa
gaacttgcaaaaaaagtacgtgtcttgtgttggatcatgactggtccaaaaaatcatcaa
agtaaagctcaacatgtgaaagcaacatggggaaaacgttgcaatattcttttatttatg
agttctgctgaagatacaaatttacctacagttgttttatcagtaaaagaaggaagagat
aatttatgggcaaaaaccaaagaagcttttaaatatgcttatgaaaagtacaaagacaaa
gttgattggtttatgaaagctgatgatgatacatatgtggtggtagaaaatttacgatat
atgttatcatcttatgactcaaattcgccattatattttggctgtagatttaaaccattt
gtgaaacaaggatacatgagtggtggtgcaggatatgtacttagtaaggaagctttgcgt
aaatttgtggaagaggctttgcctaataaaacaaagtgtcgttcagacaatggaggtgca
gaagatgtagaaatgggaaagtgcctggaaaaagtaaatgtcaaagcgatggatactcga
gatccacatggtcgtggaagatttttcccctttgtaccagaacatcatttaattcctaat
cacatggataagaatttctggtactggaagtatatttattacgataccaaagatggtctc
aattgttgttcagatagtgcgatttcatttcactatgtgtcacctaatatgatgtatgtt
cttgagtacttaatttatcacttaagaccgtatggtatcacacatagtatagagaaactt
actacagatcagtcaattactgtattgactgaatactag

DBGET integrated database retrieval system