KEGG   Apis mellifera (honey bee): 409286Help
Entry
409286            CDS       T01057                                 

Gene name
bsk, GB16401
Definition
JNK MAP kinase basket
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
ame  Apis mellifera (honey bee)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Hippo signaling pathway - fly
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ame04141]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:ame04310]
Environmental Information Processing; Signal transduction; Hippo signaling pathway -fly [PATH:ame04391]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:ame04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG3
AA seq 540 aa AA seqDB search
MDRIAFIHSLNNRFDRSGWKSCSCRNIILSHSLRIQSLNVDLSQWPLVYDESGAHKKRGA
KRRGGGGVVRKRGAEKKRRGAGAGPDTGPGARAPRADEKTGARGHVSFRPGTLALRSKVA
KSVSPHRVHQECSSGGEVQVQVQQERRAPRRMPYLGPDMTTRLSAMFYTVEVGDTRFTIL
KRYQNLKPIGSGAQGIVCAAYDTVTAQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHK
NIIGLLNAFTPQRSLDEFQDVYLVMELMDANLCQVIQMDLDHERMSYLLYQMLCGIKHLH
SAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMGYK
ENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPAQEFMQRLQPTVRNYVENR
PRYPGYPFDRLFPDVLFPSDSSEHNRLKASQARDLLSRMLVIDPERRISVDDALLHNYIN
VWYDEGEVNAPAPGPYDHSVDEREHTVDQWKELIYQEVMEYETSHNPTTVAQTSESGESR
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcatcgccttcatccattcgcttaataacagattcgatcgttccggatggaaa
tcgtgctcctgtcgtaacattatattatctcactcgcttcggattcagtccctcaacgtc
gacctttcacaatggccgctcgtttatgacgaatccggcgcgcataagaagcgaggagca
aagcggcggggcggcggcggcgtcgtccggaagcgaggagcagagaagaagcggcgtggt
gccggcgccggtcccgacaccggtcccggtgcacgtgcccctcgggctgacgagaaaaca
ggggcaagaggccacgtttcctttcggccaggtacgctcgcactacggtccaaagtggct
aagagcgtaagtcctcatcgagtgcaccaggagtgctcgagcggaggggaggtgcaggta
caggtgcagcaggagagacgagcaccgaggcgcatgccttacctggggcctgatatgaca
acccggctatccgccatgttttacacggtcgaagtcggggacaccagattcactattctc
aagcggtatcagaatttgaagccgatcggttccggtgcgcagggaatcgtttgcgcggcg
tacgacacggtgacagcgcagaatgtcgcgatcaagaaactgtcgagaccttttcaaaac
gttacgcacgcgaagagggcctacagggaattcaagctgatgaagctggtcaatcacaaa
aacataatcggtttgttgaacgcgttcacgccacaacggtccttggacgagtttcaagac
gtttacttagtgatggaacttatggacgcgaatctatgccaggtaatccagatggatctg
gatcacgaacgtatgtcttatctgctttatcaaatgctgtgcggcatcaaacacttacac
tcggccggtatcattcacagggatttaaagccgagcaatatagtggtaaaggccgactgt
acattgaagattctcgattttggcctggccagaactgccgggaccactttcatgatgacg
ccatacgttgtgacacgatattatagggcgccagaggtgatcctcgggatgggatacaag
gagaacgtggacatttggtcggtcgggtgcataatgggcgaaatgattcggggtggcgtc
ctctttcccgggacggatcacatcgaccaatggaacaagataatcgagcaactgggaacg
ccggcgcaggaattcatgcagcggctccagcctacggtcaggaattacgtggagaacagg
ccacggtatccgggatatccgttcgacaggttattcccggacgttctgtttccatcggat
tcgtcggaacacaacaggttgaaagctagtcaagccagggatctattgtcgcgcatgctc
gtgatcgaccccgaacgacgcatctccgtcgacgatgctttactacataattacataaac
gtgtggtacgacgagggcgaagtcaatgcccctgcaccaggcccgtacgaccatagtgtc
gatgagagggagcatacggtggaccagtggaaagagctgatctaccaggaagtgatggaa
tacgagacgagccataatcccacgacagtagctcaaacgtccgagagcggcgaatcccgg
tag

DBGET integrated database retrieval system