KEGG   Apis mellifera (honey bee): 409306Help
Entry
409306            CDS       T01057                                 

Gene name
GB16650
Definition
2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like
Orthology
K00167  
2-oxoisovalerate dehydrogenase E1 component, beta subunit [EC:1.2.4.4]
Organism
ame  Apis mellifera (honey bee)
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Module
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ame00280]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG4
AA seq 374 aa AA seqDB search
MVLSQLFTRLTNARTSFVFNLADKSVFREHVRWIQFTYYTDKSKNIPGETEKMNMYQAIN
NGLRIAMTKDPNAVIFGEDVGFGGVFRCTINLQKEFGKERVFNTPLCEQGIAGFGIGLAT
AGVTAIAEIQFADYIFPAFDQLVNEAAKIRYRSGGEFECGKLTIRAPCGAVGHGGLYHSQ
SPEAYFAHTPGLKIVMPRGAKQAKGLLLSCIEEPDPCIMFEPKILYRTAIDDVPTADYKI
EIGKAEIVREGDAATLVGWGTQVHVLLEVADLVQEELGASCEVIDLISILPWDTELVCKS
VKKTGRVIIAHEAPLTNGFGAEIISIIQEECFLHLEAPIQRVTGWDTPFPHVFEPFYLPD
KWRCFAAVKNILNY
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggtactcagtcaattgtttacgcggttaacgaatgctcgtacatctttcgtttttaat
ctagctgataaatcagtattccgcgaacatgtcagatggatacaattcacatactatact
gacaagagcaaaaatattcccggtgagactgaaaaaatgaatatgtatcaagcaataaac
aatggacttcgaattgcaatgacaaaagatcccaatgcagtgatatttggggaagacgtt
ggatttggaggagtatttcgttgtacgataaatttacaaaaagaatttggcaaagaacga
gtattcaatacaccgctttgcgaacaaggaattgctggttttggaattggtttagctact
gctggcgtaacagcaatcgcagaaattcaatttgccgattatatatttcccgcttttgat
cagttggtaaatgaagcggcgaaaataagataccgaagtggaggagaattcgagtgtggt
aagttaacaattcgggcaccttgcggtgctgtcggtcatggtggtctctatcattctcaa
agtccagaagcttattttgctcatacaccaggattaaagatcgttatgccccgcggagcg
aaacaggcgaaaggtcttttgttaagctgcatagaggaaccggatccctgcatcatgttc
gagccgaaaatattgtaccgtacagcaatagacgatgtgccgacagctgattataagata
gagatcggcaaggctgagattgtgagagaaggtgacgcagcgacactggtgggctgggga
actcaggtgcacgtactattggaggtggcagatctcgttcaggaggagcttggggcgtcc
tgcgaggtaatagacctgatttctatcctgccttgggatacggaactcgtttgtaagtcg
gtgaagaagactggccgcgtgataatcgcccacgaagctccgttgacgaatggctttgga
gcagaaataatttcgatcattcaggaagagtgttttctgcatttggaagcaccgatacaa
agggttacaggctgggacactcctttcccccacgtcttcgagccattttatcttccagat
aaatggcgatgtttcgcagctgttaagaacatcctgaactactga

DBGET integrated database retrieval system