KEGG   Apis mellifera (honey bee): 409306Help
Entry
409306            CDS       T01057                                 

Gene name
GB16650
Definition
2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like
Orthology
K00167  
2-oxoisovalerate dehydrogenase E1 component, beta subunit [EC:1.2.4.4]
Organism
ame  Apis mellifera (honey bee)
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Module
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    409306 (GB16650)
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.4  3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring)
     409306 (GB16650)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG4
AA seq 374 aa AA seqDB search
MVLSQLFTRLTNARTSFVFNLADKSVFREHVRWIQFTYYTDKSKNIPGETEKMNMYQAIN
NGLRIAMTKDPNAVIFGEDVGFGGVFRCTINLQKEFGKERVFNTPLCEQGIAGFGIGLAT
AGVTAIAEIQFADYIFPAFDQLVNEAAKIRYRSGGEFECGKLTIRAPCGAVGHGGLYHSQ
SPEAYFAHTPGLKIVMPRGAKQAKGLLLSCIEEPDPCIMFEPKILYRTAIDDVPTADYKI
EIGKAEIVREGDAATLVGWGTQVHVLLEVADLVQEELGASCEVIDLISILPWDTELVCKS
VKKTGRVIIAHEAPLTNGFGAEIISIIQEECFLHLEAPIQRVTGWDTPFPHVFEPFYLPD
KWRCFAAVKNILNY
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggtactcagtcaattgtttacgcggttaacgaatgctcgtacatctttcgtttttaat
ctagctgataaatcagtattccgcgaacatgtcagatggatacaattcacatactatact
gacaagagcaaaaatattcccggtgagactgaaaaaatgaatatgtatcaagcaataaac
aatggacttcgaattgcaatgacaaaagatcccaatgcagtgatatttggggaagacgtt
ggatttggaggagtatttcgttgtacgataaatttacaaaaagaatttggcaaagaacga
gtattcaatacaccgctttgcgaacaaggaattgctggttttggaattggtttagctact
gctggcgtaacagcaatcgcagaaattcaatttgccgattatatatttcccgcttttgat
cagttggtaaatgaagcggcgaaaataagataccgaagtggaggagaattcgagtgtggt
aagttaacaattcgggcaccttgcggtgctgtcggtcatggtggtctctatcattctcaa
agtccagaagcttattttgctcatacaccaggattaaagatcgttatgccccgcggagcg
aaacaggcgaaaggtcttttgttaagctgcatagaggaaccggatccctgcatcatgttc
gagccgaaaatattgtaccgtacagcaatagacgatgtgccgacagctgattataagata
gagatcggcaaggctgagattgtgagagaaggtgacgcagcgacactggtgggctgggga
actcaggtgcacgtactattggaggtggcagatctcgttcaggaggagcttggggcgtcc
tgcgaggtaatagacctgatttctatcctgccttgggatacggaactcgtttgtaagtcg
gtgaagaagactggccgcgtgataatcgcccacgaagctccgttgacgaatggctttgga
gcagaaataatttcgatcattcaggaagagtgttttctgcatttggaagcaccgatacaa
agggttacaggctgggacactcctttcccccacgtcttcgagccattttatcttccagat
aaatggcgatgtttcgcagctgttaagaacatcctgaactactga

DBGET integrated database retrieval system