KEGG   Apis mellifera (honey bee): 409332Help
Entry
409332            CDS       T01057                                 

Gene name
Usp7, GB17081
Definition
ubiquitin-specific protease 7
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
ame  Apis mellifera (honey bee)
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    409332 (Usp7)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     409332 (Usp7)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   409332 (Usp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG11
AA seq 1110 aa AA seqDB search
MNHVNDQENLKQLNLAPVQVNEVEEMDTQEGETPNDGGGDGNDTSPMNGESELACIVQDQ
EMEEDEARSEATFRYTVENLSKMKETQLSPPCYVRNLPWKIMVMPRSSQTQDRAPQKSLG
FFLQCNGESESSWSCYAVADLRLLSCKEGQEPFSRKIQHLFYSKENDWGFSHFMTWQDVL
DPDKGFIKDDSITLEVHVMADAPHGVSWDSKKHTGFVGLKNQGATCYMNSLLQTLYFTNQ
LRKAVYKMPTESDDSSKSVALALQRVFHELQFSDKPVGTKKLTKSFGWETLDSFMQHDVQ
EFLRVVRNXYLESKMKGTCVEGTVPKLFEGKMVSFIKCKNIDYKSTRVETFYDIQLNIKG
KKNIYESFNDYVSTESLDGDNKYDAGENGLQEAEKGVIFSSFPPVLHLHLMRFQYDPVTD
CSVKFNDRFEFYEKISLGKYLQSKETTSADYTLHAVLVHSGDNHGGHYVVFINPAGDGKW
CKFDDDVVSRCTKQEAIEHNYGGQDEDMSIAVKHCTNAYMLVYIRDSELENVLQEVKEED
IPQELVERLQEEKRLEQIRRKERTEAYLYITVNVLLEDNFDGHQGNDLYDPEHALYRVFR
VRKQCTLHEFLELLSDSLKYPIEQIRLWPLNVRSNQTCRPMPIELENDLQKSIYQCAENP
NVWNVFVELVPPDSDLTALPPFDKDTDVLLFFKLYDPKNKKIHYCGHHYMPVTAKVQELI
PILNERAGFPPDTELALYEEIKPNLVEKIDNLTEPLEKVLEELMDGDIIVFQKEGDNQMY
ELPTCREYFKDLFHRVEVTFCDKTIPNDTGFTMELSLRMTYDQMARAVAQRLGTDPYLLQ
FFKCQTYKDSPGHPLKCTFEGSLKDLVSYCKPKAKKLYYQQLSIRVNELENKKQFKCIWV
GPSLKEEKEIILYPNKNGTVATLLEEAKKQVELSENGSGKLRILEINSSKVSPGPREDVP
LDNLNTSGTKLYRIEEIPNDELNLADDEMLVPVAHFHKDIFSTFGIPFFFKIKHGEPFPK
MKERLLKKLGVQEKEFEKFAVVTMGKPHFIMDSPEYCMDLADFRIHPNQIYPLLNAGTSP
LRPWLGLEHVNKAPKRSRINYLEKAIKIYN
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgttaacgatcaagaaaatcttaaacaactcaacctggcaccagttcaggtt
aatgaagttgaagaaatggatacacaagaaggagaaacaccaaatgatggtggaggagat
ggcaatgatactagtcctatgaacggagaatcagaattagcttgtatagttcaagatcaa
gaaatggaggaagacgaagcaagatcagaagcaacatttcgctatacagtggaaaatctt
tctaaaatgaaagaaactcagttatcacctccatgttatgttcgtaatttgccatggaag
ataatggtaatgccaagatcaagtcaaacacaagatagagctcctcaaaaatcacttggt
ttcttcttgcaatgtaatggagaaagtgaatcatcgtggagttgttatgcagttgcagat
cttcgattactttcttgtaaggaaggacaggaaccatttagtagaaagattcaacatctt
ttctatagtaaagaaaatgattggggatttagtcattttatgacatggcaggatgtcttg
gatcctgataaaggttttattaaagatgattctattacacttgaggttcatgtcatggct
gatgctccacatggtgtcagttgggatagtaaaaagcatacaggatttgtaggtttaaaa
aatcaaggtgctacatgctatatgaattctttgcttcaaactttgtattttactaatcag
ttacgtaaagcagtctataaaatgccgactgaaagtgatgactctagcaaaagtgttgct
ttggctttacaaagggtatttcatgaattgcaattctctgataaaccagtaggtacaaaa
aaattaactaaaagttttggttgggaaacattggattcttttatgcaacatgatgtacaa
gaatttttacgagtggtaaggaattaatacttggaaagtaaaatgaaaggtacatgtgta
gaaggtacagtgccaaaattatttgaaggaaaaatggtgtcatttatcaaatgtaaaaat
attgattataaatcaactagagttgaaactttctatgatattcaattaaatattaaagga
aagaaaaatatttatgagtcgtttaatgattatgtgagtactgaaagtctggatggtgat
aataaatatgatgcgggagaaaatggtttacaagaggcggaaaaaggtgttatcttttca
tcatttccaccagtgttgcatttacatttaatgcgatttcaatatgatccagttacagat
tgttctgtgaaatttaatgataggtttgaattttatgaaaaaataagtcttggcaaatat
ttacaaagtaaagaaacaacaagtgcagattacacattgcatgcagtcttagttcatagt
ggggataatcatggtggacattatgttgtatttatcaatccagctggtgatggaaaatgg
tgcaaattcgacgatgatgtcgtctcaaggtgtacaaaacaagaagctattgaacacaat
tatggtggtcaagatgaggatatgtctatagctgtgaaacattgtacgaacgcctatatg
ttggtatatataagggactctgagttggaaaacgtcttacaagaagttaaggaagaggat
atacctcaagagctggtggagaggctgcaagaggagaagaggctggaacaaatacgaaga
aaggaaagaacagaagcatacttgtatataaccgtcaacgtccttcttgaggataatttt
gacggtcaccaagggaatgacttgtatgatccagaacatgctttgtatcgtgtatttcgc
gtacgtaagcagtgtaccttgcacgagtttctcgaattgctgagtgatagcttgaaatat
ccaatagaacaaattcgtctatggccactgaatgtacgttcaaaccaaacttgtagacca
atgccaattgaattagaaaatgatcttcaaaaatctatttatcaatgcgcggagaaccca
aatgtttggaatgtatttgttgaacttgttcctccagattctgatttaacagcattgcca
cctttcgataaagatactgatgttctcttattttttaaattatatgatcctaaaaataaa
aagattcattattgtggacatcattatatgcctgtcacagctaaagtccaggaacttata
ccaattttaaatgagagagctggttttccacctgatacggaattagctctttacgaagaa
attaaaccaaatttggtagaaaaaatagataatctaacagaaccattagaaaaagttctt
gaagaattaatggacggagatattattgtttttcaaaaagaaggagacaatcaaatgtat
gagcttccaacatgtagagaatattttaaagatctatttcatagagtagaagttacattt
tgtgataaaacgattcctaatgatactggttttacaatggaactttcattaagaatgaca
tatgaccaaatggcaagagctgtggcacagagacttggtacagatccttatcttttgcag
ttctttaaatgtcaaacttacaaagattcacctggacatccattaaaatgtacatttgaa
ggttcattgaaagatttggtttcttattgtaaacctaaagcgaaaaaattatattatcaa
cagcttagtattagagtaaatgaacttgaaaataaaaagcaattcaaatgtatatgggtt
ggtccatctcttaaagaagaaaaagaaattattctttatcctaacaaaaacggaacagta
gcaacattacttgaagaagctaaaaaacaagtagaattatcagaaaatggatccggaaaa
ttaaggatattagaaattaattctagtaaagtctcacctggtccaagagaagatgtacct
ttagataacttaaatacatctggtacaaaattatacaggatagaagaaattccaaatgat
gaattaaatttggcagatgatgaaatgttggttcctgttgcacatttccataaggatatt
ttttcaacatttggtattccctttttctttaaaatcaaacatggtgaaccttttccaaaa
atgaaggaaagactattgaagaaattgggagtacaggaaaaagaatttgaaaagttcgcg
gtggtaacaatgggtaaaccacactttattatggattcgccagaatattgcatggatctt
gctgattttcgtattcatccaaatcaaatttatccacttttaaatgcaggcacatcgcca
cttaggccttggcttggcctagaacacgtcaacaaagcgccaaagcgctctcgtatcaac
tacctcgaaaaggccattaaaatttacaattaa

DBGET integrated database retrieval system