KEGG   Apis mellifera (honey bee): 409387Help
Entry
409387            CDS       T01057                                 

Gene name
Uch, GB16138
Definition
ubiquitin carboxy-terminal hydrolase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     409387 (Uch)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   409387 (Uch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
Un
AA seq 234 aa AA seqDB search
MTSWIPMESNPEVMTKFLHKLGVPKDWCIVDVYGLEPDLLALVPKPVLAVILLYPLSKKG
DNSLEDEEETDKMKDANNFKDAEVFHMKQYIHNACGTIALIHSVANNQNIINLQDGFLKT
FLDDAKNLSFTECGKHLMESHGISTTHKDVAQEGQTEVPSEEEPVYHHFVAFIQKNGVLY
ELDGRKSAPINHGTTSPETLLEDAARVCKEYMARDPEEVCFTVLAFTNSDASAL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcttggataccaatggaatcaaatccagaagttatgacaaagtttttacacaaa
ttaggtgtaccaaaagattggtgtattgttgatgtttatggattggaacctgatctatta
gcccttgtacctaaaccagttcttgctgttattttattatatcctttatccaaaaagggc
gataacagtttagaagatgaagaagaaactgataaaatgaaagatgcaaataattttaaa
gatgcagaagtttttcatatgaaacaatacattcataatgcctgtggcacaattgcatta
attcacagtgttgcaaataatcaaaatatcataaatcttcaagatggttttttaaaaact
ttcttagatgatgcaaaaaatctttcttttacggaatgtggaaaacatttaatggaatca
catggtattagtactactcataaagatgttgcgcaagaaggacaaacagaggttccaagt
gaagaagaaccagtttatcatcattttgtagcattcatacaaaagaatggagttttatat
gaattagatggacgtaaatctgctcctattaatcatggtacaactagtccagaaacatta
ttagaagatgcagcacgtgtttgtaaagaatatatggctcgtgatccagaagaagtgtgt
tttacagttcttgctttcactaacagtgatgcatcagcattataa

  All links  
No link information was found.   
DBGET integrated database retrieval system