KEGG   Apis mellifera (honey bee): 409387Help
Entry
409387            CDS       T01057                                 

Gene name
Uch
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase
  KO
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     409387 (Uch)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   409387 (Uch)
Ubiquitin system [BR:ame04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    409387 (Uch)
  UBL-specific proteases (ULPs)
   409387 (Uch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
Un
AA seq 230 aa AA seqDB search
MTSWIPMESNPEFLHKLGVPKDWCIVDVYGLEPDLLALVPKPVLAVILLYPLSKKGDNSL
EDEEETDKMKDANNFKDAEVFHMKQYIHNACGTIALIHSVANNQNIINLQDGFLKTFLDD
AKNLSFTECGKHLMESHGISTTHKDVAQEGQTEVPSEEEPVYHHFVAFIQKNGVLYELDG
RKSAPINHGTTSPETLLEDAARVCKEYMARDPEEVCFTVLAFTNSDASAL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcttggataccaatggaatcaaatccagaatttttacacaaattaggtgtacca
aaagattggtgtattgttgatgtttatggattggaacctgatctattagcccttgtacct
aaaccagttcttgctgttattttattatatcctttatccaaaaagggcgataacagttta
gaagatgaagaagaaactgataaaatgaaagatgcaaataattttaaagatgcagaagtt
tttcatatgaaacaatacattcataatgcctgtggcacaattgcattaattcacagtgtt
gcaaataatcaaaatatcataaatcttcaagatggttttttaaaaactttcttagatgat
gcaaaaaatctttcttttacggaatgtggaaaacatttaatggaatcacatggtattagt
actactcataaagatgttgcgcaagaaggacaaacagaggttccaagtgaagaagaacca
gtttatcatcattttgtagcattcatacaaaagaatggagttttatatgaattagatgga
cgtaaatctgctcctattaatcatggtacaactagtccagaaacattattagaagatgca
gcacgtgtttgtaaagaatatatggctcgtgatccagaagaagtgtgttttacagttctt
gctttcactaacagtgatgcatcagcattataa

DBGET integrated database retrieval system