KEGG   Apis mellifera (honey bee): 409389Help
Entry
409389            CDS       T01057                                 

Gene name
GB13990
Definition
ubiquitin specific protease-like
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
ame  Apis mellifera (honey bee)
Pathway
Fanconi anemia pathway
Class
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:ame03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG7
AA seq 646 aa AA seqDB search
MTVLETEEDADKRSVPPRKKFCLSLSGRERTISINTSQAPQTSEREGLLNKDTCTHSISK
MLNGYRNQLSNHQDGSYDVSNSGTEGLRIATLCNLGNTCFLNSVIYTLRFAPSFLHNLHH
LATDLSNLNDKQIQTKIKSSSLGRTGVSLTSSGSRSWSSKDLLALAGPTGDNNKHRIQIA
TEKLHELFMALRASEARENSEPYQPDAFLQALRDVNPIFEGNQQQDAHELLVCLLDNIRE
TFQLLVRHRESQFGQNNDTLSDFSTEHLTDVQSEGNNSNKRSIRKSRKKKKITTRGSSSC
LVQSNLNGVSVSSRPYENVKYYMKYCMKYENGHAEFPESNGDISSHRLESKKCFISEDFE
GISLLRTTCLECEHVTERKETFCDICVPIDIDRSSEKDKEVRPMDSSEVYKRAVVTSELL
WGRDKYWCARCLRYNEARRAVCFPSLPRLLILQLKRFSTAAGSMEKINNHMPTPLTLQCF
CEECNNDQSRTTGGRSESRHVYKLYSVIMHQGATMTAGHYVAYTRLPDESAFAEYFQCDR
DSKRQTSGQSSSSTNTNSSSSDKTSGILKYFRSKPSASETKEQLIRFGCRSMDCCGIRRH
KHPSTWLECDDEAVHVIPLRELEDKLAPNPRNSATPYLLFYVRSVT
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgacagtattagaaacagaagaagatgcagataaacgttcagttcctcctaggaagaaa
ttttgcttatccctttctggtcgtgaacgtacaatttctattaatacttctcaggctcct
cagacttcagagagggagggccttttaaacaaagatacctgtactcatagtataagcaaa
atgttgaatggttatcgtaatcaattgagcaatcatcaagatggaagttatgatgtatca
aatagcggtacagaaggattaaggatagctactttatgtaatttagggaatacatgtttt
ttgaacagtgtgatatatactttacgatttgcaccatcatttctacataatttgcatcat
ttggccactgatttgtctaacttaaatgataaacaaattcaaactaaaataaaatcatca
tctttgggtagaactggtgtatcacttacatcaagtggcagtcggagttggagtagtaaa
gatttattagctttggctggacctactggagataataataaacacagaatacaaatagct
actgaaaaattacatgaattatttatggcattgcgtgcatctgaagcaagagaaaatagt
gaaccatatcagccagatgcgtttttacaagctcttagagatgtaaatcctatttttgag
ggaaatcaacaacaagatgctcatgaacttttagtatgtttacttgacaatattagggaa
acattccaattgttggtcagacatagagaaagtcaatttggacaaaataatgatacatta
tcagacttttccactgaacatttaacagatgtacaatcagaaggtaataattctaataaa
agaagcattcgtaaatcaagaaaaaagaaaaaaataacaacaagaggaagttcatcttgt
cttgtacaatcaaatttaaatggtgtatcagtatcttctagaccatacgaaaatgtgaaa
tattatatgaaatattgtatgaaatatgaaaatggtcacgccgaatttccggaaagtaat
ggagatataagtagtcatagattggaaagcaagaaatgttttatttcagaagattttgaa
ggaattagtcttttgcgaactacatgtcttgagtgtgaacatgttacagaacgaaaagaa
acattttgcgatatatgtgtgcctatagatatagacagatcaagtgaaaaagataaagaa
gtaagaccaatggatagtagcgaagtatataaacgtgcagtagttactagtgaacttctt
tggggccgagataaatattggtgcgctcgttgtcttcgatataatgaagctcgtagagct
gtatgtttcccatctttaccaagactacttatattgcaattgaaaagattttctactgca
gcagggtcaatggaaaaaatcaataatcatatgccaacaccattaacattacaatgtttt
tgtgaagaatgtaacaacgatcaatcacgaactacaggtggcagatcagaatcacgacat
gtgtataaattatattctgtaattatgcatcagggtgcaacaatgacagctggtcattat
gttgcttatactcgtttgcccgatgaatctgcatttgcagaatattttcaatgcgatcga
gatagtaagcgacaaacttctggtcagagtagtagcagcacaaatacaaattcgtcttca
tcggataaaacatctggtatattaaaatactttagaagtaaaccaagtgctagtgaaact
aaggaacaattaatcaggtttggttgccgcagtatggattgttgtggtattcgacgtcat
aaacatcctagcacgtggttagaatgtgatgacgaagcagtgcatgtaatcccattgcga
gaattagaagataaattagcgccaaatccacgaaattccgccactccttacctcctgttc
tatgtaagatctgtgacataa

DBGET integrated database retrieval system