KEGG   Apis mellifera (honey bee): 409393Help
Entry
409393            CDS       T01057                                 

Gene name
Tor, GB11213
Definition
target of rapamycin
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ame  Apis mellifera (honey bee)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    409393 (Tor)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   409393 (Tor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG11
AA seq 2442 aa AA seqDB search
MSSILVQQFVQRLKSRNEEIRNKAARDLCLYVKTELREVSQEEITAFMDEFNHHIFEMVS
GSDVNEKKGGILAIVCLIGADVGNINTRTIRFANYLRNLLPSNDVGVMELAAKTVGKLAL
VSGTYTAEYVEFEVKRAFEWLGGDRHEGKRHAAVLVLRELAVSMPTYFFQQVTPFFELIF
NAIRDPKPVIREGAVEALRAALVVTAQRETAKQMHKSQWYKQCYDEIVTGFEEIYTRERG
VNRDDRIHGSLLILNELLRCSNIQWEKNYEALMERLNCSTQQNENDILSLMPRLKTTIVS
KWSNSSQNSTNSQQTLYPSHESAVCRCLMQERLDDIYNDVMNQRISRNPHIQHALMILLP
RLAAFNKEKFTKDHLRESLAYLLMTLRSREKDRYAAFTTIGFIAVAVEDSINPYLSKIME
MIKSLLPSKETSTKKRGASLEPAVFICITLLGHAVKQVIAADVRDLLESMLQTGLSPILT
TSLRELAHSVPSLKPDISQGLLRMLSQVLMQKPLRHPGAPWTATSPISGPPTEVDIPSTV
LALKTLGTFNFDGNPLLQFVRRCADHFLTSEQAEVRLEAVRTCSRLLRLALNQPGPTVTN
TVSTVLGKLLVVGITDTDPDVRLWVLASLDDSFDIHLAQAENLSALFIAMNDEMFEIREL
AIRTIGRLSTMNPAYVMPSLRKTLIQFLTELEHSGMGRNKEQAARMLDHLVVSAPRLIRP
YMEPILKVLVPKLKEPESNPGVILAILRAIGDLAEVNGAEMQQWMPELLSILLEMLVDAS
SPEKRGVALWVLGQLVGSTGHVVKPYMQYPSLLDVLINFLKTEQQLIIRRETIRVLGLLG
ALDPYKHKMNLGQIDSQLDTLTSMADTKSEAENTQDLTTSEMLVNMSSSTLEEYYPAIAI
ATLMRIIRDPTLSQHHTMVVQAVTFIFKSLGIKCVPYISQVMPSFLNVVRTADVNFREYL
FQQLAILIAIVKQHIRNYLDDIFNLIKEFWTVNSPLQSTLILLVEHIAIALGAEFKIYLP
QLMPQILRVLTHDTSKDKSVTVKLLQALQKFGNNLDNYLHLVLPPIVKLFHATDCPITVN
KVALETVDHLADTLDFTDFASRIVHPLVRTLDQCPELRNTAMDTLCALVIQLGKKYQIFI
LLVQKIMTKHKIVNSRYEVLIDKILTETTVADGEDYLLMRHRHSRNKNRDLSLTSSDTTT
IKRLHVSASNLQKAWTATRRVSKDDWLEWLRSLSIGLLKESPSPALRSCWALAQTYSKLP
RDLFNAAFVSCWTELDDTYKAELIQTLQQALMVPDLPEITQTILNLAEFMEHCDKGPLPL
DNKILGERAMHCRAYAKALHYKEDEFHKSRNSNVFESLISINNKLQQKEAAEGLLEYVMN
QNNQQDLKVQVRWYEKLHNWDKALQLYRERLESDSTDVESTLGEMRCLEALGEWGQLHDV
ATKQWSHQNDETKQRMARMAAAAAWGLNQWESMEKYVSLIPKDTQDGAFYRAVLAIHDEQ
YNIAHQLIDSARDLLDTELTAMAGESYQRAYNAMVEVQKLAELEEVIQFKLVPERRSTIK
SMWWERLQGGQRIVEDWQKIIQVHTLVVSPQDDMYTWLKYASLCRKSGSLMLCHKTLVML
LGTDPSLTPDQALPTTHPQVTFAYCKHMWVANKREEAYNQLQRFVQMSLQPTTLSVVNQE
DEKQQEIRKRLLARCYLKLGEWLEALQGINEHSIPAVLSYYAAATEHDSTWYKAWHAFAY
TNFETVLFYKHQQGDSNTENIPGNGTHNNLSSSQYISQFTVPAVEGFFRSINLSHGNSLQ
DTLRLLTLWFDYGQWPEVYEAIVEGIRLIEINTWLQVIPQLIARIDTPRALVGRCIHHLL
IDIGKTHPQALVYPLTVASKSASHARKTAANKILKNMCEHSPTLVQQAMMASDELIRVAI
LWHELWHEGLEEASRLYFGERNVRGMFDTLEPLHAMLERGPQTLKETSFNQAYGRDLMEA
QEWCRRYKASRNVRDLNQAWDLYYHVFRRISRQLPQLTSLELQYVSPKLLLCRDLELAVP
GSYSPGQPIVRIASIHSSMQVITSKQRPRKLCIKGSNGKDYMFLLKGHEDLRQDERVMQL
FGLVNTLLLHDPDTFRRNLTIQRYAVIPLSTNSGLIGWVPHCDTLHTLIRDYREKKKILL
NIEHKIMLRMAPGYDHLMLMQKVEVFEHALEHTYGDDLSRLLWLKSPSSEVWFDRRTNYT
RSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTR
MLINAMEVTGIEGTYRRTCESVMSVLHRNKDSLMAVLEAFVYDPLLNWRLMDNAALKGKR
SDAQGMSASSNQEQSDALDSLTATLPKKGVPCSVENGGDTNQPEALNKKALAIITRVRDK
LTGRDFSHEETLSVQRQVDLLIQQATNNENLCQCYIGWCPFW
NT seq 7329 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtatacttgtacaacaatttgttcaaagacttaaatccagaaatgaagaaata
cgtaacaaagcagctagagatttatgtctctatgttaaaacagaactacgtgaagtatca
caggaagaaattacagcttttatggatgaatttaatcaccatatatttgaaatggtatct
ggttcagatgtaaatgaaaaaaaaggaggtatcttagctatagtttgccttattggagct
gatgtgggaaacattaatacaagaactataagatttgcaaattatttaaggaatttatta
ccctctaatgatgtgggtgttatggaattagctgctaaaacagttggtaagctagcatta
gtttctggtacttatacagcagaatatgtagaatttgaagtaaagcgtgcctttgaatgg
cttggtggtgatagacatgaaggtaaaagacatgctgctgttcttgttttaagagaactt
gctgtttctatgccaacatatttttttcaacaagtgacaccattttttgaactcatattt
aatgcaatacgtgatccaaaacctgtgataagagaaggtgctgttgaagcattaagagct
gctttagttgttactgcacagagggaaacagcaaagcaaatgcacaaatcacaatggtac
aaacaatgttatgatgaaatagtaacaggattcgaggaaatatatactagagaaagagga
gtaaatagggatgatagaatacatggttcactcttaatattaaatgaattattaagatgt
agtaacattcaatgggaaaaaaattatgaagctttaatggaacgattaaattgttctact
caacaaaatgagaatgatatattgtcattaatgcctcgattaaaaacaacaatagtatct
aaatggtctaattcttctcaaaattcgactaattctcaacagacattatatccatcacat
gaatctgcagtatgtcgttgtttaatgcaagaacgattagatgatatatataatgatgta
atgaatcagagaatatctagaaatccacatattcaacatgctcttatgatattgttacca
agacttgcagcatttaataaagaaaaatttacaaaagatcatttaagagaatcactagca
tatcttctaatgactttacgtagtagagaaaaagatagatatgctgcatttacaacaatt
ggatttatagcagttgcagtagaagattcgataaatccttatctttcaaaaattatggaa
atgatcaaaagtttattaccttctaaggaaacatctactaagaaacgtggagcatctttg
gagcctgcagtattcatttgtataactttacttggacatgcagtaaaacaagttatagct
gcagatgtcagagatttgttagaatctatgttacagactggattaagtcctattcttaca
acttctctcagagaactagctcatagtgttccatcattaaaacctgatatatctcaagga
cttttacgaatgttatctcaagttttgatgcagaaacccttaagacatcctggtgcacca
tggactgcaactagtcctatatctggtcctccaactgaagtggatattccatctacagtt
ttagctttaaaaactctaggaacatttaattttgatggtaatccacttttgcaatttgta
aggcgatgtgctgatcattttcttacatctgaacaagcagaagttcgattagaggctgta
agaacatgttcaagattattacgattagcattaaatcaacctggacctacagtgactaat
actgtctctactgttctcggaaaattattagttgtaggtataacagatacagatcctgat
gtaagactttgggttttagcttctttggatgattcatttgatattcatttagcacaagca
gaaaatctttctgcattatttattgcaatgaatgatgaaatgtttgaaataagagaatta
gcaattcgcacaatcggacgattaagcacaatgaatccagcatatgttatgccttcttta
cgtaaaacacttatacaatttttaactgaattagaacattcaggtatgggtcgtaacaag
gaacaagctgcacgaatgttggatcatttagtagtcagtgcacctagacttattcgacca
tatatggaacccattctaaaagttcttgttccaaaattaaaggagcctgaatcaaatcct
ggtgtaattttagctatattacgcgctattggtgatttagcagaagttaatggtgctgaa
atgcaacaatggatgcctgaacttctctctatactacttgaaatgttagtcgacgcgagc
tctccagaaaaaagaggagttgctttatgggttcttggacaactagtgggaagtacagga
catgttgttaagccatatatgcaatatccttcattactagatgtattgataaatttctta
aaaacagaacaacaattaattattagaagagaaactataagagttcttggattattaggt
gctttagatccttataaacataaaatgaaccttggtcagattgattctcaattggatacc
cttacttctatggctgatactaaaagtgaagctgaaaatacacaagatttaactactagt
gaaatgttggtcaatatgtcctcttcaactttagaagaatattatccagccattgctatt
gcaactcttatgagaattattcgtgatccaacattatcacaacatcatactatggtagtt
caagctgtaacttttatattcaaaagtttaggaattaaatgtgttccatatatttctcaa
gtgatgccaagttttcttaatgtagttcgtacagcagatgttaattttcgtgaatatcta
tttcaacaattggctattcttattgccattgtgaagcagcatattagaaactatttggat
gatatatttaatttaattaaagaattttggacagtgaatagtccattacagagtactctg
atacttttagttgagcacattgctattgctttgggtgcagagtttaagatttatttacca
cagttaatgccacaaatattaagagttttaacacatgacacaagtaaagataaatcagtc
acagtcaaacttcttcaagcacttcaaaaatttggaaataatctggataattatcttcat
ttagttttaccaccaattgtaaaattatttcatgctactgattgcccaataactgtaaat
aaagtagcgcttgaaacagttgatcatttagcagatacattagattttacagattttgca
tccagaattgtgcatcctttagtacgaactctagatcaatgtccagagttacgaaataca
gcaatggatacactatgtgcattggtgatacaattaggaaaaaaatatcaaatctttatt
ttactagtacaaaaaattatgacgaaacataaaattgttaattcacgttatgaagtttta
attgataaaattttgacagaaacaactgttgctgacggtgaggattatttattaatgaga
catcgacattcaagaaacaaaaatcgtgacttatcgttaacatcatctgatacaactacg
attaaaagattacacgtgtctgcctcaaatcttcaaaaagcctggactgcaacaagaaga
gtttcaaaagatgattggctggaatggctaagaagtttgtcgattggtttactcaaagaa
tcaccatcaccagcactaagatcatgttgggctcttgcacaaacttattccaaattacct
agagatttatttaatgcagctttcgtttcttgttggaccgaattggacgatacttataag
gcggaacttatacaaaccttacaacaagcattaatggttcctgatcttccagagataaca
caaacaatcttaaatttagcggaatttatggaacattgtgacaaaggaccattaccttta
gacaataaaattttaggtgaaagagcaatgcattgtagagcttatgcaaaagcattacat
tataaagaagatgaatttcataagagcaggaatagtaatgtttttgaatctttaatctct
attaataacaagcttcaacagaaagaagctgcagaaggtttactcgaatatgttatgaat
caaaataatcagcaagatctaaaagtgcaagttcgttggtacgaaaaactacataattgg
gataaagctttacaattatatagagaaagactagaaagcgattctacagatgtagagtcg
actttaggtgaaatgcgttgtttggaagcccttggagaatggggacaattgcacgatgtt
gctaccaaacaatggtctcatcaaaatgatgaaactaaacaaagaatggctagaatggca
gcagctgcagcatggggtttaaatcaatgggaaagtatggaaaaatatgtctctttaata
ccaaaagatactcaggatggtgccttttatagagctgttttagcaattcatgatgaacaa
tacaatattgcccatcaacttattgatagtgctagagatttgctagatacagaattgact
gctatggctggtgaaagctatcaaagagcttataatgctatggtagaagtccaaaaattg
gcagaactagaggaagtgatacaatttaaattagtcccagaaagaagatccactattaaa
tccatgtggtgggaaaggcttcaaggtggacaaagaatagttgaagattggcaaaagatt
atacaggttcacacattggtggtttcacctcaagatgatatgtatacatggttgaaatat
gccagtctttgcagaaaaagtggtagcttaatgttatgtcataaaacattagttatgtta
cttggaacagatccttcattaactcctgatcaggcattaccgaccactcatcctcaagta
acatttgcctattgtaaacatatgtgggtagcaaataaacgagaagaagcatacaatcaa
ctgcaaagatttgtacagatgtctttacaaccgacaactctatcagtagtcaatcaagaa
gatgagaagcaacaggaaataagaaaaagattacttgccagatgttatttgaaacttgga
gaatggttagaagcattgcaaggcataaatgaacattctataccagctgtgctatcttat
tatgctgcagctacagaacatgattctacttggtacaaagcatggcatgcttttgcttat
actaactttgaaacagttttattttataaacatcagcaaggtgactcaaatactgagaat
attccaggaaatgggactcataataatctttctagttcacagtatatatctcaatttact
gtaccagcagttgaaggattttttagatctattaatctttctcatggtaattctttgcaa
gatacacttcgtttattgaccttatggtttgattatggtcaatggccagaggtatatgaa
gctattgtcgaaggtatccgtttaattgaaatcaatacttggctacaagtaattccgcaa
cttatagcaagaatagacacaccccgagctttagttggtcgatgcatacatcatcttcta
atagatattggaaaaacgcatccacaagctttggtttatcctttgactgtagcgtcgaaa
agcgctagtcatgctagaaagactgccgccaataaaattcttaaaaatatgtgtgaacat
agtccgacattagtacaacaagcaatgatggctagcgatgaattaattagagttgcaatt
ctttggcatgaattatggcatgaaggattagaagaagctagcagattatacttcggcgaa
agaaatgttcgaggaatgtttgatacattggaacctttacatgcaatgttagaaagaggt
ccacagactttgaaagaaacgtcctttaatcaagcttatggcagagatttaatggaagca
caagaatggtgccgcagatataaagcttcacgcaatgttcgagatttaaatcaagcttgg
gatttatattatcatgtttttagaaggatatctcgacaattaccacagttaactagttta
gaacttcaatatgttagtcctaaattacttctttgtagggatttagaactggctgtaccg
ggaagttatagtccgggacagccaatagttagaatagcaagtatacatagttccatgcaa
gtaataaccagcaaacagcgaccgcgaaaattatgtataaaaggtagtaatggtaaagat
tatatgttccttttgaaaggacatgaagatctcagacaggatgaacgcgtaatgcagtta
tttggtctagtcaatactcttttattacatgatccagatacatttagaagaaatcttact
attcaaaggtatgcggtaattccactatccacaaatagtggtttaattggttgggtaccg
cattgtgatacattacatacacttatcagagattatagagaaaaaaaaaaaatactatta
aatatagaacataaaataatgctaagaatggccccaggttatgatcatcttatgcttatg
caaaaagttgaagtatttgaacatgctcttgagcatacatatggtgatgatttatcgcga
cttctttggttaaaatcaccatcaagcgaagtatggtttgatcgtaggacaaattataca
cgttctcttgctgtaatgtctatggtgggctatatccttggtcttggtgatcgacatcca
tctaatttgatgttggatcgtttaagcgggaaaatattgcatatcgattttggagattgt
tttgaagtggccatgactcgagagaaatttcctgagaaaatcccatttcgattaacaaga
atgttaatcaatgcgatggaagtaacgggaatcgagggcacatatagaagaacttgtgaa
tctgtaatgtcagtgttacatcgtaataaggatagtttaatggcagtattagaagcattt
gtatacgatcctctattaaattggcgattaatggacaatgctgcattaaaaggtaaaaga
tctgatgctcagggaatgagtgctagcagtaatcaagagcagagcgatgcattagattct
cttactgccacattaccaaagaaaggagtaccatgtagtgttgaaaatggaggtgatact
aatcaaccagaggcattaaataaaaaagcccttgctattattacaagagtaagggataaa
ttaacgggacgtgatttctctcatgaagaaacattgagtgttcaacgtcaagttgatctt
ttaattcaacaagctaccaataatgagaatttatgtcaatgttatattggatggtgtccc
ttttggtaa

DBGET integrated database retrieval system