KEGG   Apis mellifera (honey bee): 409393Help
Entry
409393            CDS       T01057                                 

Gene name
Tor
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04136  Autophagy - other
ame04140  Autophagy - animal
ame04150  mTOR signaling pathway
ame04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    409393 (Tor)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    409393 (Tor)
   04136 Autophagy - other eukaryotes
    409393 (Tor)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    409393 (Tor)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     409393 (Tor)
Protein kinases [BR:ame01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   409393 (Tor)
Membrane trafficking [BR:ame04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    409393 (Tor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 HEAT_EZ HEAT TPR_19 Clathrin
Motif
Other DBs
NCBI-GeneID: 409393
NCBI-ProteinID: XP_006566705
BEEBASE: GB44905
UniProt: A0A0B4J2L8
Position
LG11
AA seq 2442 aa AA seqDB search
MSSILVQQFVQRLKSRNEEIRNKAARDLCLYVKTELREVSQEEITAFMDEFNHHIFEMVS
GSDVNEKKGGILAIVCLIGADVGNINTRTIRFANYLRNLLPSNDVGVMELAAKTVGKLAL
VSGTYTAEYVEFEVKRAFEWLGGDRHEGKRHAAVLVLRELAVSMPTYFFQQVTPFFELIF
NAIRDPKPVIREGAVEALRAALVVTAQRETAKQMHKSQWYKQCYDEIVTGFEEIYTRERG
VNRDDRIHGSLLILNELLRCSNIQWEKNYEALMERLNCSTQQNENDILSLMPRLKTTIVS
KWSNSSQNSTNSQQTLYPSHESAVCRCLMQERLDDIYNDVMNQRISRNPHIQHALMILLP
RLAAFNKEKFTKDHLRESLAYLLMTLRSREKDRYAAFTTIGFIAVAVEDSINPYLSKIME
MIKSLLPSKETSTKKRGASLEPAVFICITLLGHAVKQVIAADVRDLLESMLQTGLSPILT
TSLRELAHSVPSLKPDISQGLLRMLSQVLMQKPLRHPGAPWTATSPISGPPTEVDIPSTV
LALKTLGTFNFDGNPLLQFVRRCADHFLTSEQAEVRLEAVRTCSRLLRLALNQPGPTVTN
TVSTVLGKLLVVGITDTDPDVRLWVLASLDDSFDIHLAQAENLSALFIAMNDEMFEIREL
AIRTIGRLSTMNPAYVMPSLRKTLIQFLTELEHSGMGRNKEQAARMLDHLVVSAPRLIRP
YMEPILKVLVPKLKEPESNPGVILAILRAIGDLAEVNGAEMQQWMPELLSILLEMLVDAS
SPEKRGVALWVLGQLVGSTGHVVKPYMQYPSLLDVLINFLKTEQQLIIRRETIRVLGLLG
ALDPYKHKMNLGQIDSQLDTLTSMADTKSEAENTQDLTTSEMLVNMSSSTLEEYYPAIAI
ATLMRIIRDPTLSQHHTMVVQAVTFIFKSLGIKCVPYISQVMPSFLNVVRTADVNFREYL
FQQLAILIAIVKQHIRNYLDDIFNLIKEFWTVNSPLQSTLILLVEHIAIALGAEFKIYLP
QLMPQILRVLTHDTSKDKSVTVKLLQALQKFGNNLDNYLHLVLPPIVKLFHATDCPITVN
KVALETVDHLADTLDFTDFASRIVHPLVRTLDQCPELRNTAMDTLCALVIQLGKKYQIFI
LLVQKIMTKHKIVNSRYEVLIDKILTETTVADGEDYLLMRHRHSRNKNRDLSLTSSDTTT
IKRLHVSASNLQKAWTATRRVSKDDWLEWLRSLSIGLLKESPSPALRSCWALAQTYSKLP
RDLFNAAFVSCWTELDDTYKAELIQTLQQALMVPDLPEITQTILNLAEFMEHCDKGPLPL
DNKILGERAMHCRAYAKALHYKEDEFHKSRNSNVFESLISINNKLQQKEAAEGLLEYVMN
QNNQQDLKVQVRWYEKLHNWDKALQLYRERLESDSTDVESTLGEMRCLEALGEWGQLHDV
ATKQWSHQNDETKQRMARMAAAAAWGLNQWESMEKYVSLIPKDTQDGAFYRAVLAIHDEQ
YNIAHQLIDSARDLLDTELTAMAGESYQRAYNAMVEVQKLAELEEVIQFKLVPERRSTIK
SMWWERLQGGQRIVEDWQKIIQVHTLVVSPQDDMYTWLKYASLCRKSGSLMLCHKTLVML
LGTDPSLTPDQALPTTHPQVTFAYCKHMWVANKREEAYNQLQRFVQMSLQPTTLSVVNQE
DEKQQEIRKRLLARCYLKLGEWLEALQGINEHSIPAVLSYYAAATEHDSTWYKAWHAFAY
TNFETVLFYKHQQGDSNTENIPGNGTHNNLSSSQYISQFTVPAVEGFFRSINLSHGNSLQ
DTLRLLTLWFDYGQWPEVYEAIVEGIRLIEINTWLQVIPQLIARIDTPRALVGRCIHHLL
IDIGKTHPQALVYPLTVASKSASHARKTAANKILKNMCEHSPTLVQQAMMASDELIRVAI
LWHELWHEGLEEASRLYFGERNVRGMFDTLEPLHAMLERGPQTLKETSFNQAYGRDLMEA
QEWCRRYKASRNVRDLNQAWDLYYHVFRRISRQLPQLTSLELQYVSPKLLLCRDLELAVP
GSYSPGQPIVRIASIHSSMQVITSKQRPRKLCIKGSNGKDYMFLLKGHEDLRQDERVMQL
FGLVNTLLLHDPDTFRRNLTIQRYAVIPLSTNSGLIGWVPHCDTLHTLIRDYREKKKILL
NIEHKIMLRMAPGYDHLMLMQKVEVFEHALEHTYGDDLSRLLWLKSPSSEVWFDRRTNYT
RSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTR
MLINAMEVTGIEGTYRRTCESVMSVLHRNKDSLMAVLEAFVYDPLLNWRLMDNAALKGKR
SDAQGMSASSNQEQSDALDSLTATLPKKGVPCSVENGGDTNQPEALNKKALAIITRVRDK
LTGRDFSHEETLSVQRQVDLLIQQATNNENLCQCYIGWCPFW
NT seq 7329 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtatacttgtacaacaatttgttcaaagacttaaatccagaaatgaagaaata
cgtaacaaagcagctagagatttatgtctctatgttaaaacagaactacgtgaagtatca
caggaagaaattacagcttttatggatgaatttaatcaccatatatttgaaatggtatct
ggttcagatgtaaatgaaaaaaaaggaggtatcttagctatagtttgccttattggagct
gatgtgggaaacattaatacaagaactataagatttgcaaattatttaaggaatttatta
ccctctaatgatgtgggtgttatggaattagctgctaaaacagttggtaagctagcatta
gtttctggtacttatacagcagaatatgtagaatttgaagtaaagcgtgcctttgaatgg
cttggtggtgatagacatgaaggtaaaagacatgctgctgttcttgttttaagagaactt
gctgtttctatgccaacatatttttttcaacaagtgacaccattttttgaactcatattt
aatgcaatacgtgatccaaaacctgtgataagagaaggtgctgttgaagcattaagagct
gctttagttgttactgcacagagggaaacagcaaagcaaatgcacaaatcacaatggtac
aaacaatgttatgatgaaatagtaacaggattcgaggaaatatatactagagaaagagga
gtaaatagggatgatagaatacatggttcactcttaatattaaatgaattattaagatgt
agtaacattcaatgggaaaaaaattatgaagctttaatggaacgattaaattgttctact
caacaaaatgagaatgatatattgtcattaatgcctcgattaaaaacaacaatagtatct
aaatggtctaattcttctcaaaattcgactaattctcaacagacattatatccatcacat
gaatctgcagtatgtcgttgtttaatgcaagaacgattagatgatatatataatgatgta
atgaatcagagaatatctagaaatccacatattcaacatgctcttatgatattgttacca
agacttgcagcatttaataaagaaaaatttacaaaagatcatttaagagaatcactagca
tatcttctaatgactttacgtagtagagaaaaagatagatatgctgcatttacaacaatt
ggatttatagcagttgcagtagaagattcgataaatccttatctttcaaaaattatggaa
atgatcaaaagtttattaccttctaaggaaacatctactaagaaacgtggagcatctttg
gagcctgcagtattcatttgtataactttacttggacatgcagtaaaacaagttatagct
gcagatgtcagagatttgttagaatctatgttacagactggattaagtcctattcttaca
acttctctcagagaactagctcatagtgttccatcattaaaacctgatatatctcaagga
cttttacgaatgttatctcaagttttgatgcagaaacccttaagacatcctggtgcacca
tggactgcaactagtcctatatctggtcctccaactgaagtggatattccatctacagtt
ttagctttaaaaactctaggaacatttaattttgatggtaatccacttttgcaatttgta
aggcgatgtgctgatcattttcttacatctgaacaagcagaagttcgattagaggctgta
agaacatgttcaagattattacgattagcattaaatcaacctggacctacagtgactaat
actgtctctactgttctcggaaaattattagttgtaggtataacagatacagatcctgat
gtaagactttgggttttagcttctttggatgattcatttgatattcatttagcacaagca
gaaaatctttctgcattatttattgcaatgaatgatgaaatgtttgaaataagagaatta
gcaattcgcacaatcggacgattaagcacaatgaatccagcatatgttatgccttcttta
cgtaaaacacttatacaatttttaactgaattagaacattcaggtatgggtcgtaacaag
gaacaagctgcacgaatgttggatcatttagtagtcagtgcacctagacttattcgacca
tatatggaacccattctaaaagttcttgttccaaaattaaaggagcctgaatcaaatcct
ggtgtaattttagctatattacgcgctattggtgatttagcagaagttaatggtgctgaa
atgcaacaatggatgcctgaacttctctctatactacttgaaatgttagtcgacgcgagc
tctccagaaaaaagaggagttgctttatgggttcttggacaactagtgggaagtacagga
catgttgttaagccatatatgcaatatccttcattactagatgtattgataaatttctta
aaaacagaacaacaattaattattagaagagaaactataagagttcttggattattaggt
gctttagatccttataaacataaaatgaaccttggtcagattgattctcaattggatacc
cttacttctatggctgatactaaaagtgaagctgaaaatacacaagatttaactactagt
gaaatgttggtcaatatgtcctcttcaactttagaagaatattatccagccattgctatt
gcaactcttatgagaattattcgtgatccaacattatcacaacatcatactatggtagtt
caagctgtaacttttatattcaaaagtttaggaattaaatgtgttccatatatttctcaa
gtgatgccaagttttcttaatgtagttcgtacagcagatgttaattttcgtgaatatcta
tttcaacaattggctattcttattgccattgtgaagcagcatattagaaactatttggat
gatatatttaatttaattaaagaattttggacagtgaatagtccattacagagtactctg
atacttttagttgagcacattgctattgctttgggtgcagagtttaagatttatttacca
cagttaatgccacaaatattaagagttttaacacatgacacaagtaaagataaatcagtc
acagtcaaacttcttcaagcacttcaaaaatttggaaataatctggataattatcttcat
ttagttttaccaccaattgtaaaattatttcatgctactgattgcccaataactgtaaat
aaagtagcgcttgaaacagttgatcatttagcagatacattagattttacagattttgca
tccagaattgtgcatcctttagtacgaactctagatcaatgtccagagttacgaaataca
gcaatggatacactatgtgcattggtgatacaattaggaaaaaaatatcaaatctttatt
ttactagtacaaaaaattatgacgaaacataaaattgttaattcacgttatgaagtttta
attgataaaattttgacagaaacaactgttgctgacggtgaggattatttattaatgaga
catcgacattcaagaaacaaaaatcgtgacttatcgttaacatcatctgatacaactacg
attaaaagattacacgtgtctgcctcaaatcttcaaaaagcctggactgcaacaagaaga
gtttcaaaagatgattggctggaatggctaagaagtttgtcgattggtttactcaaagaa
tcaccatcaccagcactaagatcatgttgggctcttgcacaaacttattccaaattacct
agagatttatttaatgcagctttcgtttcttgttggaccgaattggacgatacttataag
gcggaacttatacaaaccttacaacaagcattaatggttcctgatcttccagagataaca
caaacaatcttaaatttagcggaatttatggaacattgtgacaaaggaccattaccttta
gacaataaaattttaggtgaaagagcaatgcattgtagagcttatgcaaaagcattacat
tataaagaagatgaatttcataagagcaggaatagtaatgtttttgaatctttaatctct
attaataacaagcttcaacagaaagaagctgcagaaggtttactcgaatatgttatgaat
caaaataatcagcaagatctaaaagtgcaagttcgttggtacgaaaaactacataattgg
gataaagctttacaattatatagagaaagactagaaagcgattctacagatgtagagtcg
actttaggtgaaatgcgttgtttggaagcccttggagaatggggacaattgcacgatgtt
gctaccaaacaatggtctcatcaaaatgatgaaactaaacaaagaatggctagaatggca
gcagctgcagcatggggtttaaatcaatgggaaagtatggaaaaatatgtctctttaata
ccaaaagatactcaggatggtgccttttatagagctgttttagcaattcatgatgaacaa
tacaatattgcccatcaacttattgatagtgctagagatttgctagatacagaattgact
gctatggctggtgaaagctatcaaagagcttataatgctatggtagaagtccaaaaattg
gcagaactagaggaagtgatacaatttaaattagtcccagaaagaagatccactattaaa
tccatgtggtgggaaaggcttcaaggtggacaaagaatagttgaagattggcaaaagatt
atacaggttcacacattggtggtttcacctcaagatgatatgtatacatggttgaaatat
gccagtctttgcagaaaaagtggtagcttaatgttatgtcataaaacattagttatgtta
cttggaacagatccttcattaactcctgatcaggcattaccgaccactcatcctcaagta
acatttgcctattgtaaacatatgtgggtagcaaataaacgagaagaagcatacaatcaa
ctgcaaagatttgtacagatgtctttacaaccgacaactctatcagtagtcaatcaagaa
gatgagaagcaacaggaaataagaaaaagattacttgccagatgttatttgaaacttgga
gaatggttagaagcattgcaaggcataaatgaacattctataccagctgtgctatcttat
tatgctgcagctacagaacatgattctacttggtacaaagcatggcatgcttttgcttat
actaactttgaaacagttttattttataaacatcagcaaggtgactcaaatactgagaat
attccaggaaatgggactcataataatctttctagttcacagtatatatctcaatttact
gtaccagcagttgaaggattttttagatctattaatctttctcatggtaattctttgcaa
gatacacttcgtttattgaccttatggtttgattatggtcaatggccagaggtatatgaa
gctattgtcgaaggtatccgtttaattgaaatcaatacttggctacaagtaattccgcaa
cttatagcaagaatagacacaccccgagctttagttggtcgatgcatacatcatcttcta
atagatattggaaaaacgcatccacaagctttggtttatcctttgactgtagcgtcgaaa
agcgctagtcatgctagaaagactgccgccaataaaattcttaaaaatatgtgtgaacat
agtccgacattagtacaacaagcaatgatggctagcgatgaattaattagagttgcaatt
ctttggcatgaattatggcatgaaggattagaagaagctagcagattatacttcggcgaa
agaaatgttcgaggaatgtttgatacattggaacctttacatgcaatgttagaaagaggt
ccacagactttgaaagaaacgtcctttaatcaagcttatggcagagatttaatggaagca
caagaatggtgccgcagatataaagcttcacgcaatgttcgagatttaaatcaagcttgg
gatttatattatcatgtttttagaaggatatctcgacaattaccacagttaactagttta
gaacttcaatatgttagtcctaaattacttctttgtagggatttagaactggctgtaccg
ggaagttatagtccgggacagccaatagttagaatagcaagtatacatagttccatgcaa
gtaataaccagcaaacagcgaccgcgaaaattatgtataaaaggtagtaatggtaaagat
tatatgttccttttgaaaggacatgaagatctcagacaggatgaacgcgtaatgcagtta
tttggtctagtcaatactcttttattacatgatccagatacatttagaagaaatcttact
attcaaaggtatgcggtaattccactatccacaaatagtggtttaattggttgggtaccg
cattgtgatacattacatacacttatcagagattatagagaaaaaaaaaaaatactatta
aatatagaacataaaataatgctaagaatggccccaggttatgatcatcttatgcttatg
caaaaagttgaagtatttgaacatgctcttgagcatacatatggtgatgatttatcgcga
cttctttggttaaaatcaccatcaagcgaagtatggtttgatcgtaggacaaattataca
cgttctcttgctgtaatgtctatggtgggctatatccttggtcttggtgatcgacatcca
tctaatttgatgttggatcgtttaagcgggaaaatattgcatatcgattttggagattgt
tttgaagtggccatgactcgagagaaatttcctgagaaaatcccatttcgattaacaaga
atgttaatcaatgcgatggaagtaacgggaatcgagggcacatatagaagaacttgtgaa
tctgtaatgtcagtgttacatcgtaataaggatagtttaatggcagtattagaagcattt
gtatacgatcctctattaaattggcgattaatggacaatgctgcattaaaaggtaaaaga
tctgatgctcagggaatgagtgctagcagtaatcaagagcagagcgatgcattagattct
cttactgccacattaccaaagaaaggagtaccatgtagtgttgaaaatggaggtgatact
aatcaaccagaggcattaaataaaaaagcccttgctattattacaagagtaagggataaa
ttaacgggacgtgatttctctcatgaagaaacattgagtgttcaacgtcaagttgatctt
ttaattcaacaagctaccaataatgagaatttatgtcaatgttatattggatggtgtccc
ttttggtaa

DBGET integrated database retrieval system