KEGG   Apis mellifera (honey bee): 409403Help
Entry
409403            CDS       T01057                                 

Gene name
GB17074
Definition
ubiquitin carboxyl-terminal hydrolase 30-like
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
ame  Apis mellifera (honey bee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG8
AA seq 470 aa AA seqDB search
MDVEKVAVFASIGFAIAIAIFVLWGPSPKPRKKGKVIGINNLGYTCFLNSLLQALAACPI
FIGWLKKQYDKNGKVNFISTLLSVFEKINGYAEDLYGDVTPIEIISSLGNQWKFAPGHQD
VHELFHIVLNALQAEIQSGSRKGCLSDALPQSPIMITDTKKLGDPLTFRSVSCNDIVSVN
KNPNIPNGFDKNCNNHVISSTTSISSIPMAYNKPGIILARSSELLSRNVKLEGNKESFKP
WSSLCAMSFSNTTISVEVHPFSGSLTSQLQCSCCKWKSAVHYDKLETISLPLPPLGTYIK
SYHTVEELLTRFVTSEIVQDVLCDGCGMRCLATKTLTLGKLPKCLCLHISRTTWSSSGIP
IKRDDPVKFPEILTLDPYTFTETKKRNAQGDPEATMLLSRTTIQDKHKYQLRAIVEHRGP
VDSGHFVCYRRGNKMNQWLYTSDNVVESISLIEVLCATPYLLFYERINSI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggatgtagaaaaagtcgctgtgtttgccagtataggatttgcaatagctattgcaata
tttgttttatggggtccatctcctaaacctagaaaaaaaggaaaagtcattggaatcaat
aatttaggatatacttgttttttaaattctcttttacaagctttagctgcatgtccaata
tttattggatggttaaagaaacaatatgataaaaatggaaaagttaatttcatttcaact
ttattgtccgtttttgaaaaaatcaatggatatgcagaagatttatatggtgatgtgaca
ccaattgagatcatttcatctcttggcaatcaatggaaatttgcacctggacatcaagat
gtacatgaattatttcatatagttcttaatgcattacaagcagaaattcaatctggaagt
aggaaaggttgtttgtctgatgctttaccacaaagtccaataatgataacagatacaaaa
aaattgggtgatcctttaacatttagaagtgtatcttgtaatgatattgtatcagttaat
aaaaatcctaacattccaaatggttttgataaaaattgcaacaatcatgtaatatcttca
acgacatccatatcaagtattcctatggcatataacaagccaggtataatccttgctagg
tcttcagaattgctttcaagaaatgttaaacttgaagggaataaggaatcttttaaacca
tggagttctttatgcgctatgtcattttctaatactacaatatcagtagaagtccatcca
ttttcaggttcattaactagtcaattacaatgcagctgctgtaaatggaagtctgcagtt
cattatgacaaactagaaacaatttctttacccttgccacctttgggtacatatataaaa
tcatatcatacggtggaagaattattaacacgttttgtaactagtgagattgttcaagat
gtattatgcgatggatgtggaatgcgttgtttagctactaaaactctaactctaggaaaa
cttcctaaatgtttatgtttacatatatcaagaaccacatggagttcttcaggaatacca
attaaaagagatgatccagtaaaatttcccgaaatattaactttagatccttatactttt
acagaaactaaaaaacgaaatgcacagggtgatcctgaagcaacaatgttacttagtcga
acaactatacaagataaacataaatatcaattacgtgcaatcgtagaacatcgtggacct
gttgattctggacattttgtttgctatcgacgaggaaataaaatgaatcaatggctatat
acttcagataatgtagttgagagtatatccttaattgaggttttatgtgccacaccatat
cttctcttttacgagcgtattaatagcatataa

DBGET integrated database retrieval system