KEGG   Apis mellifera (honey bee): 409430Help
Entry
409430            CDS       T01057                                 

Gene name
GB18815
Definition
serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ame  Apis mellifera (honey bee)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    409430 (GB18815)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     409430 (GB18815)
Protein phosphatases and associated proteins [BR:ame01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     409430 (GB18815)
Transcription machinery [BR:ame03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     409430 (GB18815)
Spliceosome [BR:ame03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    409430 (GB18815)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG2
AA seq 329 aa AA seqDB search
MAESDKLNIDNIIARLLEVRGARPGKNVQLTEGEIKGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDL
QNMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHD
FDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KKKLTYGGLNANRPVTPPRGGGNNKSKKK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatctgataaacttaatattgacaacatcatagctcggctcttggaagtgcgt
ggagccaggccaggaaaaaatgttcaattgacagaaggagaaataaaaggactctgcttg
aagtcacgtgaaatttttctatcgcaacctattctgttagaacttgaagcaccacttaaa
atatgtggtgatattcatggtcaatattatgatttattacgactatttgaatatggtgga
tttccaccagaaagcaactatctatttctaggagattatgttgatagaggaaaacagtct
ttagagacaatttgtctccttcttgcctataaaatcaaatatcctgaaaactttttctta
cttcgtggaaatcatgaatgtgcatccattaataggatatatggattttatgatgaatgt
aaacgacgttataacattaaattatggaaaacatttacggattgtttcaattgtttacct
gtcgcagcaatagttgatgaaaaaatattttgttgccatggtggccttagtccagatcta
caaaatatggaacagatcagacgtatcatgcgaccaacagatgtacctgatcaaggctta
ttgtgtgatttattatggtctgatccagacaaagatacaatgggttggggagaaaatgat
cgtggcgtatcgtttacatttggagctgaagtcgttgccaaatttttacataaacatgat
tttgacctcatatgtcgcgcccatcaggtagtagaagatggctatgaatttttcgcaaag
agacagttagttaccttgttttcggcaccaaattattgtggcgagttcgataatgctgga
gctatgatgtccgtagatgaaactctaatgtgtagtttccaaattctaaaaccagccgac
aagaaaaaattaacgtatggaggcttgaacgcaaatagaccagtgacacccccgcgaggt
ggtggaaataacaaaagcaagaagaagtga

DBGET integrated database retrieval system