KEGG   Apis mellifera (honey bee): 409430Help
Entry
409430            CDS       T01057                                 

Gene name
GB18815
Definition
serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ame  Apis mellifera (honey bee)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:ame03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG2
AA seq 329 aa AA seqDB search
MAESDKLNIDNIIARLLEVRGARPGKNVQLTEGEIKGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDL
QNMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHD
FDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KKKLTYGGLNANRPVTPPRGGGNNKSKKK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatctgataaacttaatattgacaacatcatagctcggctcttggaagtgcgt
ggagccaggccaggaaaaaatgttcaattgacagaaggagaaataaaaggactctgcttg
aagtcacgtgaaatttttctatcgcaacctattctgttagaacttgaagcaccacttaaa
atatgtggtgatattcatggtcaatattatgatttattacgactatttgaatatggtgga
tttccaccagaaagcaactatctatttctaggagattatgttgatagaggaaaacagtct
ttagagacaatttgtctccttcttgcctataaaatcaaatatcctgaaaactttttctta
cttcgtggaaatcatgaatgtgcatccattaataggatatatggattttatgatgaatgt
aaacgacgttataacattaaattatggaaaacatttacggattgtttcaattgtttacct
gtcgcagcaatagttgatgaaaaaatattttgttgccatggtggccttagtccagatcta
caaaatatggaacagatcagacgtatcatgcgaccaacagatgtacctgatcaaggctta
ttgtgtgatttattatggtctgatccagacaaagatacaatgggttggggagaaaatgat
cgtggcgtatcgtttacatttggagctgaagtcgttgccaaatttttacataaacatgat
tttgacctcatatgtcgcgcccatcaggtagtagaagatggctatgaatttttcgcaaag
agacagttagttaccttgttttcggcaccaaattattgtggcgagttcgataatgctgga
gctatgatgtccgtagatgaaactctaatgtgtagtttccaaattctaaaaccagccgac
aagaaaaaattaacgtatggaggcttgaacgcaaatagaccagtgacacccccgcgaggt
ggtggaaataacaaaagcaagaagaagtga

DBGET integrated database retrieval system