KEGG   Apis mellifera (honey bee): 409488Help
Entry
409488            CDS       T01057                                 

Gene name
GB10967
Definition
(RefSeq) protein-L-isoaspartate(D-aspartate) O-methyltransferase-like
  KO
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     409488 (GB10967)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
LG4
AA seq 262 aa AA seqDB search
MSLRYLICYVGLVRLDLSYLSVFMISLLFPVFEMAWFARFNGRTNQDLVEYLRTSRIIKT
ERVYEAMSAVDRGHYVRSGYAYFDAPQQIGYGATISAPHMHAYALEILEEKLFNGARALD
VGSGSGYLTACMALMTGSNGLVVGIEHIPELNLFAIENIKKDNPELVEYGRVQFVDGDGR
LGYPQLAPYDAIHVGAAAKELPHALIDQLALGGRMVLPVGSGIADQMLIQVDKTHDGSIT
QKPLTGVAFVPLTSRDNQYYIS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttcgttatttgatatgttacgttggtcttgtacgtcttgatctttcatatctg
tctgtattcatgataagtttattgtttcctgtatttgaaatggcctggtttgcgagattt
aatggaagaactaatcaagatcttgtagaatatcttaggacatcaagaataattaaaact
gaaagagtttatgaagcaatgtctgctgtagataggggacattatgttcgttctggatat
gcatattttgatgctccacaacagattggttatggtgcaactataagtgctcctcatatg
catgcatatgcattggaaatacttgaagaaaagttatttaatggtgcaagagcattagat
gtgggttctggttctggatatttaacagcatgtatggcattgatgacaggatcaaatgga
ttggttgtgggaattgaacatattcctgaattaaatttatttgctatagaaaacattaag
aaggataatccagaacttgttgaatatggtcgtgttcaatttgttgatggagatggaaga
ttaggatatccacaactagcaccatatgatgctattcatgtaggagctgctgctaaagaa
ttgccacatgcgttaattgatcaattagctcttggaggacgtatggtattaccagtaggt
tcaggaatagcagatcaaatgttaatacaggttgacaaaacacatgatgggagcattaca
caaaagcctcttacaggtgtagcttttgttccactaactagtagagataatcaatattat
atttcatga

DBGET integrated database retrieval system