KEGG   Apis mellifera (honey bee): 409523Help
Entry
409523            CDS       T01057                                 

Gene name
rl, GB15499
Definition
mitogen-activated protein kinase ERK-A
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ame  Apis mellifera (honey bee)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    409523 (rl)
   04350 TGF-beta signaling pathway
    409523 (rl)
   04068 FoxO signaling pathway
    409523 (rl)
   04150 mTOR signaling pathway
    409523 (rl)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    409523 (rl)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     409523 (rl)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   409523 (rl)
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   409523 (rl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG3
AA seq 365 aa AA seqDB search
MAGEGSASVNPNCEVVRGQTFEVGPRYTNLSYMGEGAYGMVVSAYDNVTKTKVAIKKISP
FEHQTYSQRTLREIKILTRFKHENIIDIRDILRAPTIEQMKDVYIVQCLMETDLYKLLKT
QAISNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPEH
NHAGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSRRAIFPGKHYLDQLN
HILGVLGSPSPEDLECIINEKARNYLQSLPYKPKVPWTSLFPNADLRALDLLDKMLTFNP
NKRIVVEDALAHPYLEQYYDPADEPVAEEPFKFDMELDDLPKEVLKQYIFEETILFQKNH
QENAM
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtgaaggttctgcaagtgtgaatccaaattgtgaagttgttcgtggacaaaca
ttcgaagttggtccacgatacacgaatttgtcgtacatgggtgagggtgcctacggaatg
gtcgtatctgcttatgataatgtaacaaaaacaaaggtagctattaaaaaaatttcaccc
tttgaacatcaaacatatagtcagagaacattaagggaaataaaaattttgactaggttt
aagcatgaaaatataatagatataagagatatattaagggcacctactatagaacaaatg
aaagatgtatatattgttcaatgtctaatggaaactgatctctataaacttcttaaaaca
caggctattagtaatgatcatatatgttattttctttaccaaatattaaggggattaaag
tatattcactctgcaaatgtattacatagagacttgaaaccaagcaacttgctgttaaat
accacatgtgaccttaaaatctgtgattttggtttagctagagttgctgatccagagcat
aatcatgctggttttcttactgaatatgtagcaacaaggtggtatagagctccagaaata
atgcttaattccaagggctatactaagtctatagatatttggtcagttggttgcattctt
gcagaaatgctttccagaagagcaatatttcctggtaaacactatttagatcaactaaat
catatattgggagtccttggatcgccatcccctgaggatcttgagtgtattataaacgaa
aaagcacgaaattatcttcaatcattaccatataaaccaaaggttccatggacaagttta
tttccaaatgccgatttgcgagctttagatttgttagataaaatgttaacatttaatcct
aacaaacggattgttgtagaggatgctctagcacatccttatttagagcaatattatgat
cctgctgatgaaccggttgcagaagaaccatttaagtttgacatggaattagatgatctt
ccaaaagaagtattgaaacaatatatctttgaagaaactatattatttcaaaagaatcat
caagaaaacgctatgtag

DBGET integrated database retrieval system