KEGG   Apis mellifera (honey bee): 409577Help
Entry
409577            CDS       T01057                                 

Gene name
SNF1A
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04068  FoxO signaling pathway
ame04140  Autophagy - animal
ame04150  mTOR signaling pathway
ame04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    409577 (SNF1A)
   04150 mTOR signaling pathway
    409577 (SNF1A)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    409577 (SNF1A)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    409577 (SNF1A)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     409577 (SNF1A)
Protein kinases [BR:ame01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   409577 (SNF1A)
Membrane trafficking [BR:ame04131]
 Autophagy
  Other autophagy associated proteins
   Others
    409577 (SNF1A)
Mitochondrial biogenesis [BR:ame03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    409577 (SNF1A)
  Mitophagy factors
   Other mitophagy factors
    409577 (SNF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 YukC APH Haspin_kinase Kdo CDC37_C
Motif
Other DBs
NCBI-GeneID: 409577
NCBI-ProteinID: XP_006560282
BEEBASE: GB43553
UniProt: A0A087ZXD9
Position
LG14
AA seq 515 aa AA seqDB search
MSEKIPSNQPQPIVKIGHYTLGQTLGVGTFGKVKIGEHVLTKHKVAVKILNRQKIKSLDV
VGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMIMEYVSGGELFDYIVKHGKLKEYEAR
RFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNLHVKIADFGLSNMMMDGEFLRTSCGSP
NYAAPEVISGKLYAGPEVDIWSCGIILYALLCGTLPFDDEHVPTLFRKIKSGVFPIPEYL
NKSVVSLLCHMLQVDPMKRATIEDIKKHEWFQKDLPSYLFPSPVEQDSSVIDIDAVNEVC
EKFNVKEAEVHSALLGGDPHDQLAIAYHLIIDNKRIADEAAKAELKDFYVASSPPPVAFS
PNDTNSSPLRPHPERIAPLRERQSSQGSTSSSTQGARGTPIKRAKWHLGIRSQSKPNDIM
NEVYRAMKALNFEWKIINAYSVRVRQKNKLTDRYSKMSLQLYQVDYKSYLLDFKSLSNEE
EDIGRDPTILPPQTTGHHTMEFFEMCAALITQLAR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaaattccatctaatcaaccacaaccaattgttaagataggccattatacc
cttggacaaaccttaggtgttggaacatttggtaaagtaaaaattggagaacatgtatta
acaaaacataaagttgctgtaaaaattttgaatcgtcagaagatcaaaagtttagatgtg
gttggaaagattagaagagaaatacaaaatcttaaacttttcagacatcctcatattatt
aaattatatcaagttataagcacacccacagatatatttatgataatggaatatgtatca
ggtggagagttgttcgactatattgtgaaacatggcaaactaaaggaatatgaggcacga
agattttttcaacaaattatttctggtgttgattattgtcacagacatatgatagttcat
cgagatttaaaaccagaaaatcttttgttagatcacaatctacatgtaaagatagcagat
tttggtttatcaaatatgatgatggatggagagtttttacgtacttcttgtggttctcct
aattatgcagcaccagaagtaatttcgggtaaattatatgctggtccagaagttgatatt
tggtcttgtggaataatactttatgctttactttgtggtactttaccatttgatgatgaa
catgtaccaacacttttccgtaaaattaaatctggagttttccctattccagagtatctg
aataaaagtgttgtaagtcttttatgtcatatgttgcaagtggatcctatgaaaagagca
actattgaagatatcaagaaacatgaatggtttcaaaaggatttaccttcatatttattt
ccttcgcctgttgaacaagactcttctgtaatcgatatagacgcagtaaatgaagtttgt
gaaaaatttaatgtaaaagaagctgaagttcattctgcattattaggtggagatcctcat
gatcaattggcaattgcttatcacttgataatagacaataaaagaattgcagatgaagct
gctaaagcagaattaaaagatttctatgtagcttctagtccacctcctgttgctttcagt
cctaatgataccaatagtagtcctctgagaccacatccagaaagaatagcgccattacga
gaaagacaaagttctcaaggaagcacatcatcctcaacacaaggtgctcgtggtacacca
ataaaacgggctaaatggcatttaggaattcgttcgcaatctaaaccaaatgatattatg
aatgaagtttatcgagcaatgaaagctcttaattttgaatggaaaattataaatgcttac
agtgttagagttcgtcaaaaaaataaattaacagatagatatagtaagatgtcattacaa
ctttatcaagttgattataaaagttacttattagattttaaatccttatcaaatgaagaa
gaagatattggacgagatcctacaattctaccacctcaaacaacaggtcatcatacaatg
gaattctttgaaatgtgtgcagcattaatcacacaattagctcgataa

DBGET integrated database retrieval system