KEGG   Apis mellifera (honey bee): 409577Help
Entry
409577            CDS       T01057                                 

Gene name
SNF1A, GB15108
Definition
SNF1A/AMP-activated protein kinase
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ame  Apis mellifera (honey bee)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    409577 (SNF1A)
   04150 mTOR signaling pathway
    409577 (SNF1A)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    409577 (SNF1A)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     409577 (SNF1A)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   409577 (SNF1A)
Mitochondrial biogenesis [BR:ame03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    409577 (SNF1A)
  Mitophagy factors
   Other mitophagy factors
    409577 (SNF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG14
AA seq 515 aa AA seqDB search
MSEKIPSNQPQPIVKIGHYTLGQTLGVGTFGKVKIGEHVLTKHKVAVKILNRQKIKSLDV
VGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMIMEYVSGGELFDYIVKHGKLKEYEAR
RFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNLHVKIADFGLSNMMMDGEFLRTSCGSP
NYAAPEVISGKLYAGPEVDIWSCGIILYALLCGTLPFDDEHVPTLFRKIKSGVFPIPEYL
NKSVVSLLCHMLQVDPMKRATIEDIKKHEWFQKDLPSYLFPSPVEQDSSVIDIDAVNEVC
EKFNVKEAEVHSALLGGDPHDQLAIAYHLIIDNKRIADEAAKAELKDFYVASSPPPVAFS
PNDTNSSPLRPHPERIAPLRERQSSQGSTSSSTQGARGTPIKRAKWHLGIRSQSKPNDIM
NEVYRAMKALNFEWKIINAYSVRVRQKNKLTDRYSKMSLQLYQVDYKSYLLDFKSLSNEE
EDIGRDPTILPPQTTGHHTMEFFEMCAALITQLAR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaaattccatctaatcaaccacaaccaattgttaagataggccattatacc
cttggacaaaccttaggtgttggaacatttggtaaagtaaaaattggagaacatgtatta
acaaaacataaagttgctgtaaaaattttgaatcgtcagaagatcaaaagtttagatgtg
gttggaaagattagaagagaaatacaaaatcttaaacttttcagacatcctcatattatt
aaattatatcaagttataagcacacccacagatatatttatgataatggaatatgtatca
ggtggagagttgttcgactatattgtgaaacatggcaaactaaaggaatatgaggcacga
agattttttcaacaaattatttctggtgttgattattgtcacagacatatgatagttcat
cgagatttaaaaccagaaaatcttttgttagatcacaatctacatgtaaagatagcagat
tttggtttatcaaatatgatgatggatggagagtttttacgtacttcttgtggttctcct
aattatgcagcaccagaagtaatttcgggtaaattatatgctggtccagaagttgatatt
tggtcttgtggaataatactttatgctttactttgtggtactttaccatttgatgatgaa
catgtaccaacacttttccgtaaaattaaatctggagttttccctattccagagtatctg
aataaaagtgttgtaagtcttttatgtcatatgttgcaagtggatcctatgaaaagagca
actattgaagatatcaagaaacatgaatggtttcaaaaggatttaccttcatatttattt
ccttcgcctgttgaacaagactcttctgtaatcgatatagacgcagtaaatgaagtttgt
gaaaaatttaatgtaaaagaagctgaagttcattctgcattattaggtggagatcctcat
gatcaattggcaattgcttatcacttgataatagacaataaaagaattgcagatgaagct
gctaaagcagaattaaaagatttctatgtagcttctagtccacctcctgttgctttcagt
cctaatgataccaatagtagtcctctgagaccacatccagaaagaatagcgccattacga
gaaagacaaagttctcaaggaagcacatcatcctcaacacaaggtgctcgtggtacacca
ataaaacgggctaaatggcatttaggaattcgttcgcaatctaaaccaaatgatattatg
aatgaagtttatcgagcaatgaaagctcttaattttgaatggaaaattataaatgcttac
agtgttagagttcgtcaaaaaaataaattaacagatagatatagtaagatgtcattacaa
ctttatcaagttgattataaaagttacttattagattttaaatccttatcaaatgaagaa
gaagatattggacgagatcctacaattctaccacctcaaacaacaggtcatcatacaatg
gaattctttgaaatgtgtgcagcattaatcacacaattagctcgataa

DBGET integrated database retrieval system