KEGG   Apis mellifera (honey bee): 409624Help
Entry
409624            CDS       T01057                                 

Gene name
GB10851
Definition
acetate-CoA ligase 1
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    409624 (GB10851)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    409624 (GB10851)
   00620 Pyruvate metabolism
    409624 (GB10851)
   00640 Propanoate metabolism
    409624 (GB10851)
Enzymes [BR:ame01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     409624 (GB10851)
Lipid biosynthesis proteins [BR:ame01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   409624 (GB10851)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG7
AA seq 541 aa AA seqDB search
MPMILELPIVMLACTRIGAIHSVVFGGYSADSLAERILDSKSKILITTDGVWRGEKLLLL
KTICNEALNKAKKNGHEVECCIVVSHLKRLTNPQNTKSNILGKTNGVNSESDGYNYDIPQ
VAWDDDRDVWWHEEMEEAENKCYPVWMNAEDPLFILYTSGSTGKPKGVLHTTAGYLIYAA
TTFKYVFDYHPGDVYWCTADIGWITGHTYVVYGPLANGATSIIFEGTPFYPKNDRFWTII
EKYKVTQFYTAPTAIRSLMKFGDDLVKKHDLSFLKVLGSVGEPINTEAWLWFYNLIGNGR
CSISDTFWQTETGGHVITPLPGATPMKPGSATFPFFGVLPEILDEDGHLIEGEGEGYLVF
RQPWPGMMRSLYGNHQRFQNTYFDRFYGFYCTGDGARRDADGYFWITGRIDDMLNVSGHL
MSTAEVENILTEHSSVTEAAAVSKPHPIKGQCLYCFITPNEGVKFDKKLQDELKNKVREQ
IGPFAQPDIIQLAPGLPKTRSGKIMRRVLRKIAAGDRNVGDISTLADESIVNTLFELRPQ
I
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgatcttagaattacctatcgtcatgctcgcatgtacccgaattggggctatt
cacagtgtagtgtttggtggatactcggcggattcactggcagagcgtatcttggattcg
aaatcgaaaattttgattacgactgatggagtatggagaggcgagaaacttttattatta
aaaactatttgtaatgaggctttgaataaggctaaaaagaatggtcacgaggttgaatgt
tgtatagtagtgtcacatctaaaaagattgactaatccacaaaatactaaatcaaatata
ttagggaaaacaaatggagtgaacagtgaaagtgatggatataactatgacatccctcaa
gttgcatgggacgatgatcgtgatgtttggtggcatgaggaaatggaagaggctgagaat
aaatgttatccagtttggatgaatgcggaagatccactctttattctgtatacaagtggt
tccacaggaaaaccaaaaggtgtccttcataccactgctggatatttaatttatgcagcc
acaacgtttaaatatgtgtttgattatcatccgggcgatgtatattggtgcacagctgat
attggttggatcactggtcatacttatgttgtatatggtccactggcaaatggagctact
tccattatttttgaaggaacaccattttatccaaaaaatgatcgattctggacaattatc
gaaaaatataaagttacacaattttatactgcgccgactgcaattagatcattaatgaaa
tttggagatgatttggtgaagaaacatgatttatcttttttaaaggttttgggttcggtt
ggagaaccaataaatactgaagcttggctatggttttacaatcttattggtaatggtagg
tgcagtatatcagacacgttttggcaaacagaaaccggaggccatgtaatcacccctctt
cctggtgctacgccaatgaaaccaggttctgcaacattcccattctttggcgttttgcca
gaaattctggatgaagatggtcacttaatcgaaggtgaaggtgagggatatcttgttttt
cgtcaaccgtggccgggaatgatgcggtctctttatggaaatcatcaacgttttcaaaac
acatattttgatagattttatggattttattgcactggagatggtgctagacgtgatgca
gatggttatttctggataacgggtcgtattgatgacatgttaaatgtttctggccatctc
atgtctacagcggaagtagaaaatatattaacggaacattcttcagtaactgaagctgca
gcagttagtaagcctcatcctataaaaggacaatgtctttattgttttatcacacctaat
gaaggtgttaaatttgacaaaaaacttcaagatgaactcaaaaataaagtacgagaacaa
atcggtcctttcgctcaaccggatattattcaacttgctccaggactaccaaaaactcga
tcaggaaaaattatgagacgtgttcttagaaaaatcgcagcaggagatagaaatgtcggt
gatatatcaacattagctgatgagagcattgtcaatactcttttcgaattaaggccacaa
atttaa

DBGET integrated database retrieval system