KEGG   Apis mellifera (honey bee): 409624Help
Entry
409624            CDS       T01057                                 

Gene name
GB10851
Definition
acetate-CoA ligase 1
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ame01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ame00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ame00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ame00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG7
AA seq 541 aa AA seqDB search
MPMILELPIVMLACTRIGAIHSVVFGGYSADSLAERILDSKSKILITTDGVWRGEKLLLL
KTICNEALNKAKKNGHEVECCIVVSHLKRLTNPQNTKSNILGKTNGVNSESDGYNYDIPQ
VAWDDDRDVWWHEEMEEAENKCYPVWMNAEDPLFILYTSGSTGKPKGVLHTTAGYLIYAA
TTFKYVFDYHPGDVYWCTADIGWITGHTYVVYGPLANGATSIIFEGTPFYPKNDRFWTII
EKYKVTQFYTAPTAIRSLMKFGDDLVKKHDLSFLKVLGSVGEPINTEAWLWFYNLIGNGR
CSISDTFWQTETGGHVITPLPGATPMKPGSATFPFFGVLPEILDEDGHLIEGEGEGYLVF
RQPWPGMMRSLYGNHQRFQNTYFDRFYGFYCTGDGARRDADGYFWITGRIDDMLNVSGHL
MSTAEVENILTEHSSVTEAAAVSKPHPIKGQCLYCFITPNEGVKFDKKLQDELKNKVREQ
IGPFAQPDIIQLAPGLPKTRSGKIMRRVLRKIAAGDRNVGDISTLADESIVNTLFELRPQ
I
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgatcttagaattacctatcgtcatgctcgcatgtacccgaattggggctatt
cacagtgtagtgtttggtggatactcggcggattcactggcagagcgtatcttggattcg
aaatcgaaaattttgattacgactgatggagtatggagaggcgagaaacttttattatta
aaaactatttgtaatgaggctttgaataaggctaaaaagaatggtcacgaggttgaatgt
tgtatagtagtgtcacatctaaaaagattgactaatccacaaaatactaaatcaaatata
ttagggaaaacaaatggagtgaacagtgaaagtgatggatataactatgacatccctcaa
gttgcatgggacgatgatcgtgatgtttggtggcatgaggaaatggaagaggctgagaat
aaatgttatccagtttggatgaatgcggaagatccactctttattctgtatacaagtggt
tccacaggaaaaccaaaaggtgtccttcataccactgctggatatttaatttatgcagcc
acaacgtttaaatatgtgtttgattatcatccgggcgatgtatattggtgcacagctgat
attggttggatcactggtcatacttatgttgtatatggtccactggcaaatggagctact
tccattatttttgaaggaacaccattttatccaaaaaatgatcgattctggacaattatc
gaaaaatataaagttacacaattttatactgcgccgactgcaattagatcattaatgaaa
tttggagatgatttggtgaagaaacatgatttatcttttttaaaggttttgggttcggtt
ggagaaccaataaatactgaagcttggctatggttttacaatcttattggtaatggtagg
tgcagtatatcagacacgttttggcaaacagaaaccggaggccatgtaatcacccctctt
cctggtgctacgccaatgaaaccaggttctgcaacattcccattctttggcgttttgcca
gaaattctggatgaagatggtcacttaatcgaaggtgaaggtgagggatatcttgttttt
cgtcaaccgtggccgggaatgatgcggtctctttatggaaatcatcaacgttttcaaaac
acatattttgatagattttatggattttattgcactggagatggtgctagacgtgatgca
gatggttatttctggataacgggtcgtattgatgacatgttaaatgtttctggccatctc
atgtctacagcggaagtagaaaatatattaacggaacattcttcagtaactgaagctgca
gcagttagtaagcctcatcctataaaaggacaatgtctttattgttttatcacacctaat
gaaggtgttaaatttgacaaaaaacttcaagatgaactcaaaaataaagtacgagaacaa
atcggtcctttcgctcaaccggatattattcaacttgctccaggactaccaaaaactcga
tcaggaaaaattatgagacgtgttcttagaaaaatcgcagcaggagatagaaatgtcggt
gatatatcaacattagctgatgagagcattgtcaatactcttttcgaattaaggccacaa
atttaa

DBGET integrated database retrieval system