KEGG   Apis mellifera (honey bee): 409677Help
Entry
409677            CDS       T01057                                 

Gene name
Cyp6as5, GB17434
Definition
cytochrome P450 6AS5
Orthology
K14999  
cytochrome P450, family 6 [EC:1.14.-.-]
Organism
ame  Apis mellifera (honey bee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG13
AA seq 499 aa AA seqDB search
MASSFEILCGIAVLFLALYYYLTSTFDFWKSRGVVGPKPVPFFGTTKDLILVKKSTAHFV
KDIYEKYKNEPMVGLYATRSPFLLLNDPELIKDILIRDFSKFANRGLGVFERTEPLSPHL
LNLEVERWRPLRSRLSPIFTSGKLKEMFYLIIECSLNLETYLDKLIEKNEPIECRELTAR
FTTDVIGSCAFGIDMSSMTNENSEFRRMGREVFAVNFMNVMRMKLKQFMPRLYDLLGYVM
PDRTFAPFFTRVVTDTIKYRNDNNIVRPDFINMLMELQKNPQKLENIKLTDSLIAAQAFV
FFLAGFETSSTTMSNALYELALNQDVQKKLREEINTFCPKNNKELKYDDIKEMEYLDKVF
KETLRMYPPASILMRKAISDYTFNDTKITIPKEMKIWIPAFAIHRDSAIYPNPDSFDPER
FDQDAMASRHPMHYLPFGDGPRNCIGARFAVYQTKVGLITILRNHKVEVCEKTIIPYEFD
PGAFLLSPKDGIYLKITKI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcagtttcgaaattttatgcggcattgccgtattgtttcttgccctctattac
tacctcacgtcaacgtttgatttttggaagagtcgtggagtggttggaccgaaacctgta
ccattttttggcacaacgaaggatttgatattggttaaaaaatcaacggctcatttcgtc
aaggatatttacgagaaatacaagaacgagccaatggttggtttatacgcgacgagatct
ccctttcttcttttaaatgatccagaacttatcaaagatatattaatcagagatttctcc
aaatttgcgaatcgaggattgggagtttttgaaaggacggaaccattatcaccgcatctc
ttaaatttggaagtagaaagatggcgaccattgagatccaggctctccccaatattcacg
tcaggaaaattgaaagagatgttctatctcataatcgaatgctcgttaaatttggaaacg
tatttggacaagttaatcgagaaaaatgagcccatcgagtgccgtgaattaacagcaaga
ttcacaaccgacgtgatcggttcttgcgcgttcggcatcgatatgagctcgatgacgaac
gaaaatagcgaattccgtagaatgggcagagaagtgttcgctgtcaattttatgaacgtt
atgcgaatgaagttgaaacaattcatgccaaggctgtacgatttactcggttatgtgatg
cctgaccggacattcgcaccattctttacacgagttgtgacggatacaattaagtacaga
aacgataataacattgttagaccagatttcatcaacatgttgatggagcttcagaaaaat
ccacagaaattggaaaatatcaaattgacggattcacttatcgcagcccaagcatttgta
ttctttcttgcgggctttgaaacttcatcgacgactatgagtaatgctctctatgagtta
gctttaaatcaagatgtacagaagaagctacgtgaggaaatcaatacgttttgtcctaaa
aataataaagaattgaaatatgacgacatcaaagaaatggaatatttagataaagtattt
aaagaaacgttaagaatgtatccaccagcatcgattttaatgagaaaagcaatttcggat
tatacgttcaatgacacgaaaattacgatacctaaggaaatgaaaatttggattccagcg
ttcgcgatacaccgagattcggctatttatccgaatcctgattcatttgatcctgaaaga
ttcgatcaagatgcaatggccagtcgacatcctatgcattacttaccttttggtgatggt
ccaagaaattgcattggtgcgcgttttgcggtttatcaaactaaagttggattaattact
attcttcgtaatcataaagtagaagtttgcgaaaagacaataattccttacgaatttgat
ccaggtgcatttttgttgagtccaaaagatggaatatatttgaaaataacaaaaatatga

DBGET integrated database retrieval system