KEGG   Apis mellifera (honey bee): 409708Help
Entry
409708            CDS       T01057                                 

Gene name
GB10584
Definition
glucocerebrosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ame  Apis mellifera (honey bee)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    409708 (GB10584)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    409708 (GB10584)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    409708 (GB10584)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     409708 (GB10584)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG6
AA seq 511 aa AA seqDB search
MWKAVLLIAILSAATNKSVANDCVPRSFGTNNIVCVCNSTYCDSTPEPKPSSPEKGTFHW
YVSSRDGLRLSLSKGQMGRCQNDGSLTLNIDTSKRYQTILGFGGAFTDSAGMNIKNLSEA
TQDQLIRAYFDPKDGSRYTLGRIPIGGTDFSTRAYTLDDYDDDATLQHFALAPEDVEYKI
PYARKAVELNPDLRFFSAAWSAPTWMKTNHKINGFGFLKTEYYQTFANYILKFIEEYKKN
GVDIWGVSTGNEPFDAYIPFERLNSMGWTPELVGDWIANNLGPTLANSEYNATHIFVLDD
QRLGLPWFVNEIFKNEIARNYVYGIAVHWYADILIPPVVLDQTHNNFPDKNLLMTEACEG
SFPLEKKVVLGSWERGKRYILSITQYMNHWGVGWVDWNIALNKDGGPTYINNNVDSPIIV
NPENDEFYKQPMYYALKHYSRFVDRGSVRIFITDTIEIKAAAFITPSNEIVVVAYNDNNE
KTNVVLNDVTSEDYICLELPPHSMNTVIYNK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaggcagtgttgttgatcgcaatcctgtccgctgcaacgaataaaagtgttgca
aacgactgcgtgccacgaagtttcgggacaaataatatcgtatgcgtttgcaactcgact
tactgcgacagcacaccggaaccgaagccgagcagtccagaaaaaggtacttttcactgg
tacgtatcgagcagagatggcctcaggctgagcttgtcaaaaggacaaatgggccgttgt
caaaacgatggatctttaaccctgaacatcgatacctcgaaaagatatcaaacgatcctc
ggttttggtggcgcttttaccgactcggcgggaatgaatatcaagaatctgagcgaggct
actcaggatcaattaatcagagcgtatttcgatccgaaagatggaagtagatacacgtta
ggccgtataccaataggaggaacagacttctctacgagagcctatacattggacgattac
gatgacgatgcgacgttgcaacatttcgcgcttgctcctgaagatgtcgagtataagata
ccgtatgcgaggaaagctgtcgaattgaatcccgatttaagattctttagcgccgcgtgg
tcggcgccgacatggatgaaaactaatcacaaaatcaatggatttggtttcttgaagacc
gaatattatcaaacttttgccaattacatattgaaattcatagaggaatataaaaagaat
ggagtagatatatggggtgtttcaactggaaacgaaccattcgatgcctatattcctttt
gaacgtcttaacagtatgggatggacaccagagctggttggcgattggatcgctaacaac
ttgggcccaactttggcaaattccgaatacaacgccacacatattttcgttttggacgat
caaagactaggattaccttggttcgttaacgaaatctttaaaaatgaaattgcgagaaat
tatgtttacggcatagccgtacattggtacgcggatatattgattccaccggtagtatta
gatcaaacgcacaataattttcctgacaaaaatctgttgatgaccgaagcatgtgaagga
tcttttccattggaaaaaaaggttgtgttgggatcatgggaaagaggaaaaagatatata
ttaagtataacgcagtatatgaatcattggggagttggatgggtggattggaacatagct
ttgaacaaagatggtggaccaacctatatcaataataacgtcgactcgcccattattgta
aatccggaaaatgatgaattttataaacagccgatgtattacgctcttaagcactacagc
agattcgtcgacagaggatcggtcaggattttcatcaccgacacgattgaaattaaggcc
gcagcctttataacgccctcgaacgaaattgtggttgttgcgtataacgacaataatgaa
aaaacaaatgtggttctgaacgatgtgacaagtgaagattatatttgtttggaattaccc
ccacattctatgaatactgtaatttacaacaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system