KEGG   Apis mellifera (honey bee): 409709Help
Entry
409709            CDS       T01057                                 

Gene name
GB13722
Definition
glucocerebrosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ame  Apis mellifera (honey bee)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ame00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ame00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:ame04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG6
AA seq 511 aa AA seqDB search
MNTKHWAKLLFLISFFFRKSIANDCAPYRVDNEIIACVCNATYCDGIPDNIPEVPTEGNS
YWYVSNKQGLRMNVSEVKFDRCENFVADTTITVDSKKKYQKIIGFGGAFTDATGINIAKL
SRATQEQLIRAYYDPKKGSRYTLGRIPIGSTDFSTRIYTYDDAPGDKLLKNFSLAPEDYN
YKIPYVKLAVELNPEVLLFAAAWTAPLWMKQFDNNITYLKEEHYETYVNYLIKFLDKYER
NGVNIWGITPSNEPLLGFMIDNPNISMTWIPKTQANWIANYFGPILASSPFNKTLLLTYD
DNRIKAIEYVKAAIEIGGKYIAGIGIHWYKDSTYPATIIDRIHEKYPDKFILMTEASIFN
PIWNCSSKLKSEAWQRGEKYILSIIDYMNHWSVGWVDWNMVLDKTGGPTVVNNNLDAPII
VNPETDEFYKQPLYYAIKHVSRFVDRDSFRISIIDNNSINSTAFLTPSGETVVVLYNGAT
STKHIILKDLQKDSKLCLELSPQSMNTLKYK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgaaacactgggctaaacttctattcctaatttcttttttcttcagaaaaagt
atcgcaaacgattgtgcaccttaccgtgtagataatgaaataatcgcgtgtgtctgcaat
gcgacatattgcgacggtataccggataatattccggaagtacctacggaaggtaattcc
tattggtacgtgtcaaataagcaagggctgcgaatgaacgtgtcagaagtaaagtttgac
aggtgtgagaactttgtcgcggatacaacaatcaccgtagacagtaagaaaaaatatcaa
aaaataattgggtttggaggcgcgtttaccgatgccactggtataaacatagcgaaactc
agtcgagctactcaggaacaactgattcgtgcgtattacgatccgaaaaaaggaagcaga
tatacattgggccgtatacctattggttccaccgatttttctacgagaatttacacgtac
gacgatgctcccggtgataaattgttaaaaaacttttcccttgcaccggaagattacaat
tacaagataccatatgtaaaattagctgttgaattaaatcctgaagtactattgttcgca
gcagcatggactgccccattgtggatgaaacaattcgacaacaatatcacttatttgaaa
gaagaacactatgaaacctacgttaattatttgattaaatttttggataaatatgaaaga
aacggtgttaatatatggggaattacacctagcaatgaaccgttgctcggttttatgatc
gataatccaaatatttctatgacatggatacccaaaacacaagctaattggattgctaat
tatttcggcccgattttggcatcatcaccatttaataaaacgttacttttaacttatgac
gataatagaatcaaagcaatcgaatatgtcaaagcagcgatcgagattggaggaaaatat
attgctggaataggtatacattggtataaagattctacttatcctgcaactatcatagat
cgtatacacgagaaatatcctgacaaatttattcttatgactgaagcatccatatttaat
ccaatatggaactgtagcagtaaacttaaatcagaagcatggcaaagaggcgaaaaatat
attttaagcataatagattatatgaatcattggtcagttggatgggtagattggaatatg
gttctggataaaactggtggaccaaccgttgttaataacaatctcgacgctcctattatc
gtaaatccagaaaccgatgaattttataaacaacctttgtattatgctatcaaacacgtt
agcagattcgttgatagagattctttccgaatttctattattgataataattcgatcaat
tctacagcctttcttacaccgtcgggagaaacggttgttgtattatataatggggctact
tctacaaaacatataattctaaaggatttgcaaaaagatagtaaactttgcttggaatta
tctccgcaatctatgaacactttaaaatataaataa

DBGET integrated database retrieval system