KEGG   Apis mellifera (honey bee): 409791Help
Entry
409791            CDS       T01057                                 

Gene name
Pka-C1, Co, GB17175
Definition
cAMP-dependent protein kinase 1
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ame  Apis mellifera (honey bee)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    409791 (Pka-C1)
   04340 Hedgehog signaling pathway
    409791 (Pka-C1)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     409791 (Pka-C1)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   409791 (Pka-C1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG2
AA seq 353 aa AA seqDB search
MGNNAATANKKVDAAESVKEFLDKAKKEFEDKWKRNPTNTAGLDDFERIKTLGTGSFGRV
MIVQHKPTGEYYAMKILDKQKVVKLKQVEHTLNEKRILQAISFPFLVSLRFHFKDNSYLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVQGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKPRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKGHKWF
ASTDWIAVFQKKIEAPFIPKCKGPGDTSNFDDYEEETLRISLTEKCAKEFAEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaatgccgcgactgcaaacaaaaaggttgacgctgctgagagcgtcaaggag
tttcttgacaaggcaaagaaagagttcgaggacaagtggaaaagaaacccaacgaacact
gctggtctcgatgatttcgagcggatcaagacacttggtactggctcgttcggtcgtgtc
atgatagtgcaacacaaaccaaccggggaatattacgccatgaagatactcgacaagcaa
aaagtcgtgaaacttaagcaagtcgaacacacgcttaatgaaaaaagaatactgcaagcg
attagctttccatttttggtctccttgcgatttcacttcaaggataattcttacctttac
atggttctcgaatatgtgccgggaggcgaaatgttcagtcatctacgaaaggttggtcgt
ttctcggaaccacattcgcgcttttacgcggcacaaatcgtattagcgtttgagtatctt
cactacctcgacttaatctatagggacctcaagccagaaaatctattaatcgattcacaa
ggctatttaaaagtcacagattttggtttcgctaaaagggtacagggtagaacatggacc
ttgtgcggtacgccagaatatctcgcgcctgaaataattctcagcaaaggttataataaa
gctgtggattggtgggcgcttggtgtgcttgtctatgagatggctgccggttatccaccg
ttctttgctgatcaaccaattcaaatttatgagaagattgttagcggaaagccacgattt
ccgtctcatttcggatccgatttgaaagacttactacgtaacttgctacaagttgatctt
accaaaaggtatgggaatttgaaggctggtgtaaacgatatcaagggtcacaagtggttc
gccagtaccgattggatagccgtcttccaaaagaaaatcgaggccccgttcataccaaaa
tgtaaagggccaggagacacgagcaatttcgacgactatgaggaggagacacttaggatt
tcactgacggagaagtgcgccaaggaattcgccgaattttga

DBGET integrated database retrieval system