KEGG   Apis mellifera (honey bee): 409791Help
Entry
409791            CDS       T01057                                 

Gene name
Co, Pka-C1
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ame  Apis mellifera (honey bee)
Pathway
Longevity regulating pathway - multiple species
Wnt signaling pathway
Hedgehog signaling pathway - fly
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    409791 (Co)
   04341 Hedgehog signaling pathway - Fly
    409791 (Co)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    409791 (Co)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     409791 (Co)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   409791 (Co)
Messenger RNA biogenesis [BR:ame03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     409791 (Co)
Chromosome [BR:ame03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    409791 (Co)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG2
AA seq 353 aa AA seqDB search
MGNNAATANKKVDAAESVKEFLDKAKKEFEDKWKRNPTNTAGLDDFERIKTLGTGSFGRV
MIVQHKPTGEYYAMKILDKQKVVKLKQVEHTLNEKRILQAISFPFLVSLRFHFKDNSYLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVQGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKPRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKGHKWF
ASTDWIAVFQKKIEAPFIPKCKGPGDTSNFDDYEEETLRISLTEKCAKEFAEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaatgccgcgactgcaaacaaaaaggttgacgctgctgagagcgtcaaggag
tttcttgacaaggcaaagaaagagttcgaggacaagtggaaaagaaacccaacgaacact
gctggtctcgatgatttcgagcggatcaagacacttggtactggctcgttcggtcgtgtc
atgatagtgcaacacaaaccaaccggggaatattacgccatgaagatactcgacaagcaa
aaagtcgtgaaacttaagcaagtcgaacacacgcttaatgaaaaaagaatactgcaagcg
attagctttccatttttggtctccttgcgatttcacttcaaggataattcttacctttac
atggttctcgaatatgtgccgggaggcgaaatgttcagtcatctacgaaaggttggtcgt
ttctcggaaccacattcgcgcttttacgcggcacaaatcgtattagcgtttgagtatctt
cactacctcgacttaatctatagggacctcaagccagaaaatctattaatcgattcacaa
ggctatttaaaagtcacagattttggtttcgctaaaagggtacagggtagaacatggacc
ttgtgcggtacgccagaatatctcgcgcctgaaataattctcagcaaaggttataataaa
gctgtggattggtgggcgcttggtgtgcttgtctatgagatggctgccggttatccaccg
ttctttgctgatcaaccaattcaaatttatgagaagattgttagcggaaagccacgattt
ccgtctcatttcggatccgatttgaaagacttactacgtaacttgctacaagttgatctt
accaaaaggtatgggaatttgaaggctggtgtaaacgatatcaagggtcacaagtggttc
gccagtaccgattggatagccgtcttccaaaagaaaatcgaggccccgttcataccaaaa
tgtaaagggccaggagacacgagcaatttcgacgactatgaggaggagacacttaggatt
tcactgacggagaagtgcgccaaggaattcgccgaattttga

DBGET integrated database retrieval system