KEGG   Apis mellifera (honey bee): 409796Help
Entry
409796            CDS       T01057                                 

Gene name
Adam, GB12381
Definition
eukaryotic translation initiation factor 3 subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ame  Apis mellifera (honey bee)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    409796 (Adam)
Translation factors [BR:ame03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    409796 (Adam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
Un
AA seq 236 aa AA seqDB search
MDDEWDVENAEAKFDLAIRSNKWEGEDEDEDVKDSWEDVEEEKKDVEKPAEVPKAKPKPK
KALAERIEEREKKARAEAERKAKEKEEALTPEERRAEQLRRQRLQEEADLRLAMETFGVT
EESVLSLDTIVPNTKEEFEQYGSVLTQKLNQFAKHSEFPLFGEELIKSVALNLPSSHLKK
VKTLIDNLLIEKQRIEKAEKAKKNKGKGKAKLKIEGDNTLLSEYGDYVYDDYDDFM
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgaatgggatgtcgaaaacgctgaagcgaaatttgacctcgctattagatcc
aacaagtgggagggtgaagacgaagatgaagatgtcaaggatagttgggaagatgttgaa
gaagaaaagaaagatgtagaaaaacctgcagaagtgcctaaagctaagccaaagccaaag
aaagctttggcagaaagaattgaagaacgtgagaaaaaggcaagagcagaagcagaaaga
aaagctaaagaaaaagaggaagcattaacacctgaggaaaggagagcagaacaattaaga
cgtcaaaggctccaagaagaagctgatctacgtcttgccatggaaactttcggtgtgact
gaagaatctgtgttgagtttggataccatagtacctaatacaaaagaagaatttgagcag
tatggaagtgtacttacacaaaagctgaaccaatttgctaaacactctgagtttcctcta
tttggagaagaacttattaaatctgttgctcttaatttgccctcatcacatttgaagaag
gttaaaacattgattgataatttgttgattgaaaagcaaagaatcgaaaaagcagaaaag
gcgaaaaagaacaaaggcaagggaaaggcaaaattgaaaattgaaggtgacaatactctt
ttgagtgaatatggcgactacgtttacgatgattacgacgatttcatgtag

DBGET integrated database retrieval system