KEGG   Apis mellifera (honey bee): 409911Help
Entry
409911            CDS       T01057                                 

Gene name
ERp60, GB10238
Definition
ERp60 protein
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    409911 (ERp60)
Enzymes [BR:ame01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     409911 (ERp60)
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   409911 (ERp60)
  Exosomal proteins of colorectal cancer cells
   409911 (ERp60)
  Exosomal proteins of bladder cancer cells
   409911 (ERp60)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG1
AA seq 490 aa AA seqDB search
MLFKYFNFLFLVFASVLAEEKDVVELTDETFSHELERLENTLVMFYAPWCGHCKRLKPEY
AKAAEMLLDNDPSITLAKVDCTESGKDTCNKYSVSGYPTLKIFSKGDFVSDYNGPREAVG
IAKYMKAQVGPASKELNEENCLKSFLDSDEVSVVGFFEKEDLSLATTFHAVSKKLKEKVR
FAHTTAKSLMEKEGYKNTIVLYRPKILQNKFEANIVKYDETMGDIQEFINKNYFGIAGVR
TRDNTAEFKNPLVVAYYAVDYIKNPKGTNYWRNRIIKVAKDFPNLNFAISSKDDFQHELN
DFGIDFVKGDKPVILARNINNQKFVMKDEFSVSTFEAFLKDMEAGVLEPYLKSEPIPEDN
SGNVKIAVARNFDELVTNNDKDTLIEFYAPWCGHCKKLAPVYDELGEKLANEDVEIIKFD
ATANDVPGPYEVRGFPTLYWAPKNSKNNPVKYEGGRELDDFIKYIAKHATNELKGFDRKG
KSVKPKSDEL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgctatttaaatattttaactttctttttttggttttcgcttcagtcttagctgaagaa
aaagatgtggtggagctaaccgacgaaacttttagccatgaattagaacggcttgaaaac
acgcttgttatgttttacgcaccatggtgtggtcattgcaaacgattgaaaccagaatat
gcaaaagctgctgaaatgcttttagataatgatccatcaattactcttgctaaagttgat
tgtacagaaagtggaaaggatacttgcaataaatattctgttagtggttatccaacatta
aagatcttttctaaaggtgattttgttagtgattacaatggacctagagaagctgttggc
attgctaagtatatgaaggcacaagttggtccagcatctaaagaattaaatgaagaaaat
tgtttaaagtcatttttagattctgatgaagtaagtgttgtaggtttctttgaaaaagaa
gatttatctttagcaacaacttttcatgcggtttctaaaaaacttaaagaaaaagttaga
tttgcacacacaactgccaaatcacttatggaaaaagaaggatataagaatactattgtt
ttatatagaccaaaaattttgcaaaataaatttgaagcaaacattgtgaaatatgatgaa
actatgggtgatattcaagaatttattaataagaattattttggtattgcgggagttcgt
acacgagataatacagcagaatttaaaaatccattagttgttgcatattatgcagtagat
tatatcaagaatccaaagggtacaaactattggcgtaatagaattatcaaagttgctaag
gacttccctaatttgaactttgctatttcttccaaagatgattttcagcatgaattgaat
gattttggaattgattttgttaaaggtgataaacctgttatattggcacgaaatattaat
aaccaaaaatttgttatgaaagatgaattctctgttagtacatttgaagcatttttaaaa
gatatggaagctggtgttttagaaccatatctaaagtctgaaccaattcctgaagataat
tctggaaatgttaaaattgcggtagcccgaaattttgacgaacttgttacaaataatgac
aaagatacattgattgaattttatgcaccttggtgcggtcattgtaaaaaattagctcct
gtttatgatgaattaggagaaaaacttgcgaatgaggatgttgagatcataaagtttgat
gctactgctaatgatgttcctggcccatatgaagttcgaggttttcctacactttattgg
gcacctaaaaactctaaaaataatccagtcaaatatgaaggtggcagagagcttgatgat
tttattaaatatattgctaaacatgcaactaatgagttaaaaggatttgatcgtaaaggc
aaaagtgttaaaccgaagagtgatgaattgtaa

DBGET integrated database retrieval system