KEGG   Apis mellifera (honey bee): 409911Help
Entry
409911            CDS       T01057                                 

Gene name
ERp60, GB10238
Definition
ERp60 protein
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ame04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG1
AA seq 490 aa AA seqDB search
MLFKYFNFLFLVFASVLAEEKDVVELTDETFSHELERLENTLVMFYAPWCGHCKRLKPEY
AKAAEMLLDNDPSITLAKVDCTESGKDTCNKYSVSGYPTLKIFSKGDFVSDYNGPREAVG
IAKYMKAQVGPASKELNEENCLKSFLDSDEVSVVGFFEKEDLSLATTFHAVSKKLKEKVR
FAHTTAKSLMEKEGYKNTIVLYRPKILQNKFEANIVKYDETMGDIQEFINKNYFGIAGVR
TRDNTAEFKNPLVVAYYAVDYIKNPKGTNYWRNRIIKVAKDFPNLNFAISSKDDFQHELN
DFGIDFVKGDKPVILARNINNQKFVMKDEFSVSTFEAFLKDMEAGVLEPYLKSEPIPEDN
SGNVKIAVARNFDELVTNNDKDTLIEFYAPWCGHCKKLAPVYDELGEKLANEDVEIIKFD
ATANDVPGPYEVRGFPTLYWAPKNSKNNPVKYEGGRELDDFIKYIAKHATNELKGFDRKG
KSVKPKSDEL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgctatttaaatattttaactttctttttttggttttcgcttcagtcttagctgaagaa
aaagatgtggtggagctaaccgacgaaacttttagccatgaattagaacggcttgaaaac
acgcttgttatgttttacgcaccatggtgtggtcattgcaaacgattgaaaccagaatat
gcaaaagctgctgaaatgcttttagataatgatccatcaattactcttgctaaagttgat
tgtacagaaagtggaaaggatacttgcaataaatattctgttagtggttatccaacatta
aagatcttttctaaaggtgattttgttagtgattacaatggacctagagaagctgttggc
attgctaagtatatgaaggcacaagttggtccagcatctaaagaattaaatgaagaaaat
tgtttaaagtcatttttagattctgatgaagtaagtgttgtaggtttctttgaaaaagaa
gatttatctttagcaacaacttttcatgcggtttctaaaaaacttaaagaaaaagttaga
tttgcacacacaactgccaaatcacttatggaaaaagaaggatataagaatactattgtt
ttatatagaccaaaaattttgcaaaataaatttgaagcaaacattgtgaaatatgatgaa
actatgggtgatattcaagaatttattaataagaattattttggtattgcgggagttcgt
acacgagataatacagcagaatttaaaaatccattagttgttgcatattatgcagtagat
tatatcaagaatccaaagggtacaaactattggcgtaatagaattatcaaagttgctaag
gacttccctaatttgaactttgctatttcttccaaagatgattttcagcatgaattgaat
gattttggaattgattttgttaaaggtgataaacctgttatattggcacgaaatattaat
aaccaaaaatttgttatgaaagatgaattctctgttagtacatttgaagcatttttaaaa
gatatggaagctggtgttttagaaccatatctaaagtctgaaccaattcctgaagataat
tctggaaatgttaaaattgcggtagcccgaaattttgacgaacttgttacaaataatgac
aaagatacattgattgaattttatgcaccttggtgcggtcattgtaaaaaattagctcct
gtttatgatgaattaggagaaaaacttgcgaatgaggatgttgagatcataaagtttgat
gctactgctaatgatgttcctggcccatatgaagttcgaggttttcctacactttattgg
gcacctaaaaactctaaaaataatccagtcaaatatgaaggtggcagagagcttgatgat
tttattaaatatattgctaaacatgcaactaatgagttaaaaggatttgatcgtaaaggc
aaaagtgttaaaccgaagagtgatgaattgtaa

DBGET integrated database retrieval system