KEGG   Apis mellifera (honey bee): 409925Help
Entry
409925            CDS       T01057                                 

Gene name
Dsor1, GB13922
Definition
dual specificity mitogen-activated protein kinase kinase dSOR1
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ame  Apis mellifera (honey bee)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    409925 (Dsor1)
   04068 FoxO signaling pathway
    409925 (Dsor1)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    409925 (Dsor1)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     409925 (Dsor1)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   409925 (Dsor1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 414 aa AA seqDB search
MSKNKLNLTLPPGSIEPVPAVSPSPPVPSLPIYSEPPVIPDGVMGKMSIDAIQERLEELE
MDEEQRKRLESFLGQKEKVGELCDEDFEKLGELGAGNGGVVMKVRHKKYGLIMARKLIHL
EVKPAIKKQIIRELKVLHECNFAHIVGFYGAFYSDGEISICMEYMDGGSLDLILKKAGRI
PEPILSTITSAVLKGLSYLRDKHAIMHRDVKPSNILVNSAGEIKICDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPDEKTLAAIFNTPTGQ
PPAESAATNNASTPTQSPGHNTGSPRPMAIFELLDYIVNEPPPKLPAGIFSDAFTDFVDR
CLKKNPSERADLKTLMNHEWIKKAESENVDIAGWVCRTMDLQPTTPTRLANVQS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaacaagttaaatttgacattacctcctggttcaatagaaccagttccagct
gtatcaccatcaccaccagtaccatcgttacctatttattctgaaccaccagtaatacca
gatggagtaatgggaaaaatgagtatagatgctattcaagaaaggttagaggaattagaa
atggatgaagagcaaagaaaaagattagaaagttttttaggtcaaaaagaaaaagttggg
gaattatgtgatgaagattttgaaaaacttggtgaacttggtgctggtaatggtggtgtt
gttatgaaagtgagacataaaaaatatggactaataatggcaagaaagttaatacattta
gaagttaaacctgcaattaagaaacaaataatcagagaattaaaagtacttcacgagtgt
aattttgcacatatagttggattttatggtgctttttatagtgatggagaaattagtata
tgtatggaatatatggatggtggttcattagatttaatattgaaaaaagctggaagaatt
ccagaacctatactaagcacaattacatcagcagttttgaaaggtttaagctatttgcga
gataaacatgcgattatgcatcgagatgtaaaaccaagcaatatcttagtaaatagcgct
ggagaaataaaaatttgcgattttggtgtttccggacaattaatcgattctatggctaat
tcatttgtcggaacgagaagttatatgtcgccagaaagacttcaaggtacacattattct
gttcaaagtgatatttggtctctaggattatcacttgtggaaatggcaattggaatgtat
ccaattccacctccagatgaaaaaactttagctgcaatatttaatactccgacaggtcaa
ccacctgcagaaagtgcagctacaaataatgcttctactccaacgcaatccccaggacat
aatacgggtagtccaagaccgatggctatattcgagttattggattatatcgtgaatgaa
ccaccaccaaaattgcccgctggtatttttagcgatgcttttacagattttgtggatcgt
tgtttgaaaaaaaatccttctgaaagggcagatttaaaaacactaatgaatcatgaatgg
attaaaaaagctgaatctgaaaatgtagatatcgctggttgggtatgtcgtacaatggat
ttacaaccgactactccaacgcgtttagcgaatgtacaatcctga

DBGET integrated database retrieval system