KEGG   Apis mellifera (honey bee): 409985Help
Entry
409985            CDS       T01057                                 

Gene name
GB10400
Definition
ubiquitin carboxyl-terminal hydrolase 48-like
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
ame  Apis mellifera (honey bee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG14
AA seq 937 aa AA seqDB search
MMMLMILTMRTCCSKCGTEYPTSTTFYELDLQLAATLKEAIEKYLSVEQLTGANQYHCVT
CNDKKDARRFIRLESLPETLNIQLMRFVFHRDSGQKRKLNSFIQFPEDLDMSEYVRCPLQ
THLYSLVAVLSHKGPSAHSGHYIANICNSNGEWYQFSDDKVEKMQNKRIEDGVNENSKII
KRGRIPKGFLSSNTAYMLVYKKVTSEKRINNTKKNKLKKLDTETNSNYNTMHEENLVIVK
DKSVSLDEEKCKYDTISVSDVNNSEKMLKLGIETKQEMEISKASENIVMEVSVREESTFD
EQNGKHYEFDNKENQHDIFIKKSLAKVVKIDYKRLNGAAHRAMSCGERDFYEEMEFENWE
VSPTLRDLVRQENVKHELSLLATQQEKQKEIEDQNLKRQLVIDVYNIISNIISWEKYQWI
PSDWLSKWLNGHSFIDGVPPIDNSTLMCTHYRLDPLKVNRAKCIPIAAADILYEKYRGGP
RLDENSFCEVCVKRRYKLLRFKMSLERDYKEVSELIRNFKEPFETSYVVGADSLRSWRRL
AMEKFMDDMEQEIEDEDCQDPNSIQEDRKSESKESERIKESGEGEENEVIIYFNEDLLCE
HGSLKTPDSTRKIVPREAWMILRKYFPGSKEYPIGSSSCSICEEKMENAQKAKKDDKIKA
KQQKDELNDLYHGKNRNEILKCEEPEKAFYIVEKGFLDSWRSFLRYAEVFSKTPPVGIRN
GVLLCEPHKGFLYSPSISNELFTIVTAEEWAKLMQFYDVDYPIIIKKNNSDLQTEPSLCA
ACMLARVEQERLESLKYDRATIYIKCVEDNEDTKSENDSEMPAKRPKLENTRPSRTRRNL
KGSHELKVSSEITLKELKLMTMQICGAGPYDQHLMLGEHELTDHSQSLAALGIFPGALLT
LKIDTPIENEADVTSDANNPESSFPEKGFKGTELVPS
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgctgatgatcttgacgatgagaacatgttgctcgaaatgcggaactgaatat
ccaacgtccacaacgttctacgaattggatctacaacttgcagccactttgaaagaggca
atagagaaatacttgtctgtggaacagttgactggagcaaatcagtatcactgcgttacc
tgcaatgacaaaaaagatgcgcgccgttttatacgcttggaatctcttccagaaacatta
aatatacagttaatgcgttttgtgtttcatagagattctgggcagaaaagaaagttgaat
tcttttatacaatttcccgaagatcttgatatgtcagaatatgtgaggtgtccattacaa
actcatttgtacagtcttgtagcagttttgagtcataaaggaccatctgcacattcgggt
cattatattgcaaatatatgcaattcaaatggggaatggtatcaatttagtgatgataaa
gtagaaaaaatgcagaataaaagaatcgaggatggagttaatgagaattcaaagattata
aaacgaggtcgtataccgaaaggatttttatcttctaacactgcatacatgttagtttat
aaaaaagttacttctgaaaaacgaataaataatacaaaaaaaaataagttaaaaaaatta
gatacagaaactaatagcaattataacacaatgcatgaagaaaacctcgtgatagttaaa
gataaatcagtttcattagatgaagaaaaatgtaaatatgatacaatttccgtttcggat
gtgaataattctgagaaaatgttaaagcttggaatagagactaaacaggaaatggaaatt
tcgaaggcatcagaaaatattgtaatggaagtatctgtaagagaggagtctacttttgat
gaacaaaatggcaaacattacgaattcgataataaagaaaatcagcatgatatatttatc
aaaaaatcattagccaaagttgtgaagatagactacaaacgtttaaacggtgccgcacat
agagctatgagttgtggggaacgtgacttttacgaagagatggaatttgaaaattgggaa
gtgagtccaacattgcgtgatttagtgagacaagaaaatgtgaaacatgaattgagttta
ttggcgactcaacaagaaaaacaaaaggagattgaagatcagaacttaaagagacaactt
gtcatagatgtatataatattatttcgaatataatttcatgggagaaatatcaatggatt
ccaagtgattggttatcaaaatggctaaatggacattcattcatcgatggggtgccacca
atagataattctacattgatgtgtacgcattatcgacttgatcctttaaaagtgaatcgg
gcaaaatgtattcctatagctgctgcagatatactttatgaaaaatatcgtggtggacca
cgtttggatgaaaactctttttgcgaagtttgtgtgaaacgtcgatataaattacttcgt
ttcaagatgtcacttgaacgtgattacaaggaagttagtgaacttattcgcaattttaaa
gaaccattcgagactagttatgttgtgggtgctgattcattgagatcgtggcgaagactt
gcaatggagaaatttatggacgatatggaacaagaaattgaggatgaagattgtcaagat
ccgaatagtattcaagaagataggaaaagtgaaagcaaggaaagtgaacgaataaaggaa
tcaggagagggagaagagaacgaagttataatttatttcaacgaagatttactttgtgag
catggttcattgaaaacaccagactcaacaagaaaaatagtaccccgcgaagcttggatg
atacttcgaaaatactttccaggatctaaggagtatcctatcggttctagctcatgttcc
atttgcgaggaaaaaatggaaaatgcacaaaaggcaaaaaaagatgataaaataaaagcc
aaacaacaaaaggacgagttaaatgatttatatcatggtaaaaatagaaatgaaatatta
aaatgtgaagagccagaaaaagcattttatatcgtggagaagggatttttggacagttgg
cgttctttccttcggtatgccgaagtgttctcgaaaacaccaccggttggtattcgaaac
ggtgtcctcctctgcgagccgcacaaaggattcctctactcgccttccattagcaacgag
ctgtttaccatcgtaacggccgaggaatgggcgaaattgatgcagttttacgacgtcgat
tatccgatcatcatcaaaaagaataattccgatcttcaaacagagccaagtttgtgcgcg
gcgtgcatgttggcgagagtggagcaagaacgtctggagagtctcaagtacgacagggcg
acgatttatataaagtgcgtggaggataacgaggatacgaagtcggagaacgacagtgag
atgcccgccaagagaccgaagctggagaacacgaggccgtcgaggaccaggcggaacttg
aaggggtcccacgagctcaaagtttcctcggagatcacgttgaaggagctgaaactgatg
accatgcaaatttgcggcgctggaccttacgaccaacatctaatgctgggtgaacacgag
ctgaccgatcatagtcaaagcctcgctgctcttggtatatttcccggggcgcttctcacc
ttgaagatcgacacgccgatcgagaacgaagcggacgtgacgtcggatgcgaacaacccc
gagtccagcttcccggaaaagggtttcaagggaaccgaattggtgccgagttga

DBGET integrated database retrieval system