KEGG   Apis mellifera (honey bee): 409985Help
Entry
409985            CDS       T01057                                 

Gene name
GB10400
Definition
ubiquitin carboxyl-terminal hydrolase 48-like
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     409985 (GB10400)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   409985 (GB10400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG14
AA seq 937 aa AA seqDB search
MMMLMILTMRTCCSKCGTEYPTSTTFYELDLQLAATLKEAIEKYLSVEQLTGANQYHCVT
CNDKKDARRFIRLESLPETLNIQLMRFVFHRDSGQKRKLNSFIQFPEDLDMSEYVRCPLQ
THLYSLVAVLSHKGPSAHSGHYIANICNSNGEWYQFSDDKVEKMQNKRIEDGVNENSKII
KRGRIPKGFLSSNTAYMLVYKKVTSEKRINNTKKNKLKKLDTETNSNYNTMHEENLVIVK
DKSVSLDEEKCKYDTISVSDVNNSEKMLKLGIETKQEMEISKASENIVMEVSVREESTFD
EQNGKHYEFDNKENQHDIFIKKSLAKVVKIDYKRLNGAAHRAMSCGERDFYEEMEFENWE
VSPTLRDLVRQENVKHELSLLATQQEKQKEIEDQNLKRQLVIDVYNIISNIISWEKYQWI
PSDWLSKWLNGHSFIDGVPPIDNSTLMCTHYRLDPLKVNRAKCIPIAAADILYEKYRGGP
RLDENSFCEVCVKRRYKLLRFKMSLERDYKEVSELIRNFKEPFETSYVVGADSLRSWRRL
AMEKFMDDMEQEIEDEDCQDPNSIQEDRKSESKESERIKESGEGEENEVIIYFNEDLLCE
HGSLKTPDSTRKIVPREAWMILRKYFPGSKEYPIGSSSCSICEEKMENAQKAKKDDKIKA
KQQKDELNDLYHGKNRNEILKCEEPEKAFYIVEKGFLDSWRSFLRYAEVFSKTPPVGIRN
GVLLCEPHKGFLYSPSISNELFTIVTAEEWAKLMQFYDVDYPIIIKKNNSDLQTEPSLCA
ACMLARVEQERLESLKYDRATIYIKCVEDNEDTKSENDSEMPAKRPKLENTRPSRTRRNL
KGSHELKVSSEITLKELKLMTMQICGAGPYDQHLMLGEHELTDHSQSLAALGIFPGALLT
LKIDTPIENEADVTSDANNPESSFPEKGFKGTELVPS
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgctgatgatcttgacgatgagaacatgttgctcgaaatgcggaactgaatat
ccaacgtccacaacgttctacgaattggatctacaacttgcagccactttgaaagaggca
atagagaaatacttgtctgtggaacagttgactggagcaaatcagtatcactgcgttacc
tgcaatgacaaaaaagatgcgcgccgttttatacgcttggaatctcttccagaaacatta
aatatacagttaatgcgttttgtgtttcatagagattctgggcagaaaagaaagttgaat
tcttttatacaatttcccgaagatcttgatatgtcagaatatgtgaggtgtccattacaa
actcatttgtacagtcttgtagcagttttgagtcataaaggaccatctgcacattcgggt
cattatattgcaaatatatgcaattcaaatggggaatggtatcaatttagtgatgataaa
gtagaaaaaatgcagaataaaagaatcgaggatggagttaatgagaattcaaagattata
aaacgaggtcgtataccgaaaggatttttatcttctaacactgcatacatgttagtttat
aaaaaagttacttctgaaaaacgaataaataatacaaaaaaaaataagttaaaaaaatta
gatacagaaactaatagcaattataacacaatgcatgaagaaaacctcgtgatagttaaa
gataaatcagtttcattagatgaagaaaaatgtaaatatgatacaatttccgtttcggat
gtgaataattctgagaaaatgttaaagcttggaatagagactaaacaggaaatggaaatt
tcgaaggcatcagaaaatattgtaatggaagtatctgtaagagaggagtctacttttgat
gaacaaaatggcaaacattacgaattcgataataaagaaaatcagcatgatatatttatc
aaaaaatcattagccaaagttgtgaagatagactacaaacgtttaaacggtgccgcacat
agagctatgagttgtggggaacgtgacttttacgaagagatggaatttgaaaattgggaa
gtgagtccaacattgcgtgatttagtgagacaagaaaatgtgaaacatgaattgagttta
ttggcgactcaacaagaaaaacaaaaggagattgaagatcagaacttaaagagacaactt
gtcatagatgtatataatattatttcgaatataatttcatgggagaaatatcaatggatt
ccaagtgattggttatcaaaatggctaaatggacattcattcatcgatggggtgccacca
atagataattctacattgatgtgtacgcattatcgacttgatcctttaaaagtgaatcgg
gcaaaatgtattcctatagctgctgcagatatactttatgaaaaatatcgtggtggacca
cgtttggatgaaaactctttttgcgaagtttgtgtgaaacgtcgatataaattacttcgt
ttcaagatgtcacttgaacgtgattacaaggaagttagtgaacttattcgcaattttaaa
gaaccattcgagactagttatgttgtgggtgctgattcattgagatcgtggcgaagactt
gcaatggagaaatttatggacgatatggaacaagaaattgaggatgaagattgtcaagat
ccgaatagtattcaagaagataggaaaagtgaaagcaaggaaagtgaacgaataaaggaa
tcaggagagggagaagagaacgaagttataatttatttcaacgaagatttactttgtgag
catggttcattgaaaacaccagactcaacaagaaaaatagtaccccgcgaagcttggatg
atacttcgaaaatactttccaggatctaaggagtatcctatcggttctagctcatgttcc
atttgcgaggaaaaaatggaaaatgcacaaaaggcaaaaaaagatgataaaataaaagcc
aaacaacaaaaggacgagttaaatgatttatatcatggtaaaaatagaaatgaaatatta
aaatgtgaagagccagaaaaagcattttatatcgtggagaagggatttttggacagttgg
cgttctttccttcggtatgccgaagtgttctcgaaaacaccaccggttggtattcgaaac
ggtgtcctcctctgcgagccgcacaaaggattcctctactcgccttccattagcaacgag
ctgtttaccatcgtaacggccgaggaatgggcgaaattgatgcagttttacgacgtcgat
tatccgatcatcatcaaaaagaataattccgatcttcaaacagagccaagtttgtgcgcg
gcgtgcatgttggcgagagtggagcaagaacgtctggagagtctcaagtacgacagggcg
acgatttatataaagtgcgtggaggataacgaggatacgaagtcggagaacgacagtgag
atgcccgccaagagaccgaagctggagaacacgaggccgtcgaggaccaggcggaacttg
aaggggtcccacgagctcaaagtttcctcggagatcacgttgaaggagctgaaactgatg
accatgcaaatttgcggcgctggaccttacgaccaacatctaatgctgggtgaacacgag
ctgaccgatcatagtcaaagcctcgctgctcttggtatatttcccggggcgcttctcacc
ttgaagatcgacacgccgatcgagaacgaagcggacgtgacgtcggatgcgaacaacccc
gagtccagcttcccggaaaagggtttcaagggaaccgaattggtgccgagttga

DBGET integrated database retrieval system