KEGG   Apis mellifera (honey bee): 410100Help
Entry
410100            CDS       T01057                                 

Gene name
eIF3-S9, GB10123
Definition
eukaryotic translation initiation factor 3 subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ame  Apis mellifera (honey bee)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    410100 (eIF3-S9)
Messenger RNA biogenesis [BR:ame03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     410100 (eIF3-S9)
Translation factors [BR:ame03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    410100 (eIF3-S9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG14
AA seq 702 aa AA seqDB search
MAKKMLADKTPQNEDNIKNNDDTFNEDEEPNFSDPEGFIDDITDEELLGDILKQKPSETD
GVESVIVIDGVPQVEPERLEKLQSVISKVLGKFGTIVNQYYPKNENGYTKGYIFLEYNNP
LNALAAAQSVNNYKIDKQHTFKVNLFTDFKKFEEIPDEWEPPKPQEFKAAADLHYYLLEP
DAYDQFCVLCGNGPSVTVQVWQNSAPEPTLLEERSRWTETYVKWSPLGTYLATFHKLGVA
LWGGPQFLQQARFSQKGVECIDFSPGERYLVTYTPRTDLGSEQKRLVIWDILTGQEKRAF
FADGSSVWPIFRWSHDDKYLARMGEDILSVYETPSFGLLDKKSIKIPGIRDFSWSPTDNV
LAYWVPEDKDVPARVTLLEIPNRNEIRNKNLFNVADCKIYWQKSGDYLCVKVDRFAKRKE
KTEQKYTGMSYNFEIFHMREKQIPVDSVEIKEPIHAFAWEPVGSKFAIIHGEIPSVNVSF
YEVRYGHQPALLKKLEKKACNHLFWSPSGQFIVLAGLTTMAGALEFIDTNDFTIMNSTDH
YQTSDVEWDPTGRYVVTAVSSWKTSVDNGYWIWTFQGRILKRVNLNQFNQLLWRPRPPTL
LTPEQIKEIKKNLKKYSAQFESKDRMRLTRASKELIEKRCAAMKAFEEYRSKRIQEWNNQ
KKRRLELRNGIDTDELDSDSKNVEEEVIEFFVKEETFIIDEK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaaatgttagcagataaaactcctcaaaatgaggataatattaaaaataat
gatgatacatttaacgaagatgaagaaccaaattttagtgatcctgaaggatttattgac
gatattactgacgaagaattacttggcgatattttgaaacaaaaaccctcagagacagat
ggagtagaatcagtaattgtcattgatggagtcccccaagttgaaccagaaagattggaa
aaacttcaatctgttattagcaaagtattgggaaagtttggaacaatagtaaatcaatat
taccccaaaaatgaaaatggatatacgaaaggatacatatttctagaatataacaatcct
cttaatgccttagcagctgcgcaatctgtaaataattataaaattgacaagcaacataca
ttcaaagtaaatttattcactgatttcaagaaatttgaagaaattccagatgaatgggaa
cctccaaaaccacaagaatttaaagcagcagctgatcttcattattatcttttagaacca
gatgcttatgatcaattttgtgtgctttgtggtaatggtccttctgttactgttcaagtt
tggcaaaattctgcccctgaaccaacgttacttgaagaacgttctcgttggacagagaca
tatgttaaatggtctccattaggaacatatttagcaacattccataaattgggtgttgca
ttatggggtggccctcaatttttgcaacaagctagattcagccaaaaaggtgttgaatgt
atagatttctctcctggcgagcgttatttagtaacatatactccaagaactgatcttggt
tctgaacaaaaacgtcttgtaatttgggacatccttactggtcaagaaaaacgtgcgttt
ttcgcagatggttcttcagtatggcctattttccgttggtcacatgatgataaatatctt
gctcgtatgggagaagatattttgagtgtttatgaaacaccttcatttggattattggat
aagaaaagtataaaaattcctggtatcagagattttagttggtctcctacagataatgtt
cttgcttattgggtaccagaagataaagatgttccagcaagagttactcttctcgaaatt
ccaaatcgtaatgaaattcgcaacaaaaatttgtttaatgtggctgattgtaaaatttat
tggcaaaaatcaggggattatctttgtgtaaaagttgatcgtttcgctaaacgtaaagaa
aagacagaacaaaaatacacgggtatgtcatataattttgaaatttttcatatgagagaa
aaacaaatacctgtcgatagtgttgaaataaaagaaccaattcatgcatttgcttgggaa
cctgtgggaagcaaatttgctattattcatggagaaattccaagtgttaatgttagtttt
tacgaagtacgatatggtcatcaaccagctcttctcaaaaaattggaaaaaaaggcttgc
aatcatctattttggtcgccatctggtcaatttattgttcttgctggattaacaaccatg
gcaggagctttagaattcattgatactaatgattttactatcatgaattcaactgatcat
tatcaaacttcagatgtagaatgggatcctactggacgatacgtggtaacagctgtttcc
agttggaaaaccagtgtggataatggatattggatatggacgttccaaggacgtatatta
aaaagagttaatctcaatcaatttaatcaactcttatggagaccaagaccaccaacatta
ttgacaccggaacaaattaaagaaattaagaaaaatttaaagaaatattctgcgcaattc
gaaagtaaagatcgtatgcgattaactcgtgcttcaaaggaattaattgagaaacgttgt
gcagcgatgaaagcattcgaagaatatcgttcaaaacgcatacaagaatggaataatcaa
aagaagagacgtttagaattacgtaatggtattgatacagacgaattagattctgattcc
aaaaatgtagaagaagaagtaatagaatttttcgtcaaagaagaaacatttatcatcgac
gagaaataa

DBGET integrated database retrieval system