KEGG   Apis mellifera (honey bee): 410171Help
Entry
410171            CDS       T01057                                 

Gene name
GB17792
Definition
filamin-A-like
Orthology
K04437  
filamin
Organism
ame  Apis mellifera (honey bee)
Brite
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   410171 (GB17792)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG10
AA seq 2935 aa AA seqDB search
MESTEQLRPEELVGLVARSAEGTAAKGMPIKGHEDLWVEIQANTFRNWVNEHLKHAVDTA
NSPVIDLVEDFRDGTRLCALVEVLTKRRLPRWNPRPANQHHHLENVSTALQAIEADGVKL
VNIGNVDIVNGNLKLILGLIWSLIVRYQIGKSKFPPRKLMLAWLKTVLPECRVNNFTTDW
NSGVYLSALLDYCQPGLFPHWRRLDPNDSVYNCRKAMEISKREFDIPMVLEPEYLASPYM
DELSGMTYLSYFMKEGSPGFHATLRWVNSQLSHPVQNFTTDWNDGRTLCSIVRNLGGSAP
AYDKIDVDPSMWEHNIQMGIDGGKKLGVEPILKAKDMADQNVEHLGVMAYAACFQWVKPR
PQTSKQIVVHIDSTSARVQQPAHFKLEILTKEVNTREVRGEVISPSGRIECRLTWNGVHG
KGTFIPVEVGMHKLMVYNDGELVDGCPYYFRVLPPLTKIKSPGMDPCAIGSIVEVLVNSY
GTSHDGIDVTAWSPTGRSLLCPVKENDGVHTATFQPDETGEWSIAITHKGNHIQGGPFTC
FVFDPNGIKLLDTEGALPGQPFSFTVDATGTGGLGDVIIDLVHDKQSIPFRMENSRHMQY
RVSFVPSESGKYRVYIYFNGSDVRGSPFSIRVGTQKGSKRSKESSFDKTKLSSLERRMND
LNVSMETDRSSPLLKQKSYSPTTYKLSSPTQHIREYSPVHQTTSAYKTSNYLENSSSTYH
TSTSINHTRSPSHSNSPISRNLHSPSMIKDTKEIYSTTYNHSRSPTAQSPNFMKESKDIY
TSNTTSTSRSPNPSPIHGSRYSPVIKESREIYSSGSLKRSRSPDRMAYRSATQSPVNRSF
SPRNNDRDNSYNRKDFTDNGTVDTSSNVRVSSMVGGTSRRDSWDAIEKTKSLLSYGSLES
LANLTNNSAMAENNSNYFNNNYKQDYSSKNILQTHNNSPNLIQKVSTSEYNISQKYNNEN
HNIRTQTHGILKNKNNNYYKNVDITDGVHERYFNNVISSSSTQDRNYEFVTGSALETLPI
HRPATFTIDQNIDASKVTVNVCGPSGKIIPIQKSTLRGLTYSITAQEVGEHIIQILVNGQ
HIQGSPFRSQAYNAHAIQVGNIPNGVVNQPVEFEIDGSNAGSGNLEILVNGGHVTSFVRA
LGSQRFLASFVPHEAVVHLVEMTFNGEVVPGSPWRVGIMPVPKMSVIGDSIRLVPAGSPA
FFELSALGFNSNEIDVQIITPSKRYIQAKIDEVSGRSGEFRVEFTPIEVGSHLVEVTIAG
QKLPAGPLVAKVYNSSLIQVTDVPSAVVGHACQFRVDASAAGEGQLEISINEGEVPNHVQ
VVGGGRCLVSFTPETAKSHYIDIKFNGEAVKGCPFICNVSDTSRVTLSLNHLELIPVDQP
ASFHMGVDGSGNAELAVSVKGPNCELPVKVTGDIKNGFTAEFIPRDVGVHSISVEYNGHA
VNGTPFLAKAFNADKVLIGPVARGSVGQPTHFTVDASQAGEGNLEITISARNQNIPTQVT
PQGNARFSVSFVPFEACEHIINIAFNKRTVPGCPIITRVGGDSHVTVSGQALSSAGLGRQ
SYLTISNVAGSLEDLEVNVEGPNGQAVPAQVTDNKDTTCSVAFTPRVVGEHRISVSHRNV
PVIGSPFSCKVYDVTAIKVKDAKHGVIGMPVTFLVETSQAGPGNLEVTVNGGRVPTSAQA
QGPHTYAISFTPREPIVHTVDLRFNGEDVPGSPFSCQVSDTAKVIITEGLEKVSVNRLTT
FTIEADISLGTPIVEVLSPTRESLPIHVKQSGHGCYTAGFTPKDVGDHSVEVKINGLHVE
GSPFLVKAYNADKVKVTDINSGIVGKPVFFSINASQAGAGNLEIIVAVNGKNVPNYVQSE
GXAKFRVNFKPQEAAVHSLSVRFNGEPVPGSPFSCKVVGAGQAIIIGHNLKMGAVKQLMS
FIVDPQALSTNCDVIVTPPSNISLPITIEPVDGKYNISFVPVEVGRHNISILVDSEHVKG
SPFACNIYDVTKVHVSGLTEALLGQATTFTVDAAEAGEGTLELVVSTENNTVKAEVVACA
RGLYDVTFVPQTTSTHYVNISFNDDNVPGSPFKCPIISTMLDGPSMIRVGNTAYMDLEMP
GLEGPVSAEVTGPDSIIIPCTLMKLSPNLYRVEIRTRQVGTYSVIFSDGHKMISSQTLQA
FDSGKVTIKEISDVVCHRPGTITVVVSKEAGPGKLTVNVRAAGADVDSVIREGENGQYDI
IFHPTRAAPHKVHIKYNEVHILGSPLDLTVRGPTGGREVTATGLGLYQSCVNKVTSFTIE
TLGSPGKEFDVVISGPQGNAVPVRCYQHRDGNLLAEFTTSTVGTYKIDVLQGTKPVLGSP
FFCQAFDVSKVKLQELGPMTVSVHDHIVFKIIKTDAGMADLDVVATSPLGQELPLQVTPL
NDGAEMVEFSPSVPGTYMINITYGGYPIPDSPLVCTVDAAGQARAKGEGLLSGHVDKTAH
FIVTGTRSPPAVQVDGPDSVSKAVIEAGANPGTWNVSYIPTEAGVFDIRIVSAGQQLPGS
PWHPKIIDTRNLRVIGGWPAVCDDVGRLKIHPSNKISFDTAEAGPGELTGKIGDHTLSFE
MTSNNRLKLIPPKLNGGEYRLEIFFNGISFPGAPKLVIVQDLETPIQDTSRVLLRGRGLT
SAKCGEEVSFTIDGSQAGTGTPKVQLFSPTSELNVMLQHLGKYIIIFYIPLTPDPLLMTV
SWNGRQLKGCPLQINVTNAADASRVICSGDGLKHGIVGQEIRSFIDTRRAGPGELTAHCV
GPHKVAYCELYDHGDATFTLNVKPQEAGRHALTIKYAGEHVPGSPFTLRVSGAPDASKVR
VYGPGIEHGVLATFQSRFICDTRGAGAGQLTVRVRGPKGAFRVEMQRETQKDRIILCRYD
PTEPGDYRVEVRWAGVLVPGSPFPVKIVDTQDELLMLTQNGDNYSTGHHTIASWQ
NT seq 8808 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgaccgaacaattacgaccggaagaattggtgggattagtagcccgatctgct
gaaggtacagcagcgaaaggaatgcctatcaaaggacacgaagatctatgggtggaaatt
caagcgaatactttccgaaattgggtgaacgagcacttaaaacacgcagttgatactgca
aacagccctgtgatcgatcttgttgaagattttcgggacggtacacgactttgtgctctc
gtcgaagtacttactaaacgacgtttacctcgatggaatcccagacctgcaaatcaacat
catcatttagaaaatgtttcaacagcccttcaagctatcgaagctgatggtgtaaaactt
gttaatatcggtaatgtagacatcgtcaatggtaatttgaaactaattcttggactgata
tggtcactcattgtaaggtaccaaataggcaagtccaagttccctccaaggaaacttatg
ctggcatggctcaagacagttttgccagaatgtagagtcaacaattttaccacagattgg
aattctggtgtatatttgagtgctttacttgattattgtcaaccaggactatttccacat
tggcgacggcttgatccgaatgatagcgtttacaattgccgaaaagctatggagatttca
aaacgtgaattcgacatacctatggtactggaaccagaatatcttgcatcgccatatatg
gatgaactatcgggaatgacctacttatcgtacttcatgaaggaaggttcaccaggtttt
catgcaacattacgatgggttaattctcaattatctcatccagtacaaaactttacaact
gattggaatgatggtagaactttatgtagtattgtcaggaatttaggaggatctgctcct
gcttatgataaaatcgatgtcgatccttccatgtgggaacataatatacaaatgggtatt
gatggaggcaaaaaattaggtgtagaacctattcttaaagcaaaagatatggcagatcaa
aatgtagagcatttaggcgttatggcatatgcagcatgctttcaatgggtaaagcctcgc
cctcaaacaagcaaacaaattgttgttcatattgatagcacttctgcaagagtgcaacag
ccggcgcatttcaaattagaaattcttaccaaagaagtaaatacgagagaagtacgtggt
gaggtaataagtccgagcggacgaatagaatgtagattaacatggaatggagttcatgga
aaaggaacttttatacctgtagaagttggaatgcataagttaatggtatataatgacgga
gaattagtagatggatgtccgtattatttcagagttttacctcccttaaccaaaatcaaa
tcacctggcatggatccttgcgctataggatctattgttgaagttctagtcaatagttac
ggaactagtcatgatggcattgatgttactgcgtggtcacctactggaagatcactattg
tgtcctgttaaagaaaatgatggagtacacactgcaacctttcaacctgatgagacagga
gaatggagtattgcaataactcataaaggaaatcatatacaaggtggcccatttacatgt
tttgtatttgatcctaatggaataaagctattggatacggagggtgctttacctggacaa
ccattttcatttactgtcgatgcaacaggaactggaggtcttggcgacgtaataatagat
ttagttcatgataaacaatcaattcctttcagaatggaaaattctagacacatgcaatat
cgagtttcatttgttccatcagaatccggaaagtacagagtttatatatactttaatggt
tctgatgttagaggttctccattttcgattcgagtgggaactcaaaaaggatcaaaaaga
tcaaaagaatctagtttcgataaaacgaaattatcttcgctggaaaggcgaatgaatgat
ttaaatgtttcaatggaaaccgatcgatcaagtcctcttctcaagcagaaatcttattct
cccactacatataaattatctagcccaactcaacatatacgtgaatattctcctgtacat
caaactacctccgcttataaaacatcgaattatttggaaaattctagttcgacgtatcat
acatcaacttcgatcaatcatactcgatctccaagtcatagtaatagtccaatttcacga
aatcttcatagtccatctatgattaaagatacgaaagaaatttattctactacatataat
cattcaagatctccaactgcacaaagtcctaattttatgaaagaatctaaagatatttat
acatccaatacaacaagtacatctcgatctccaaatccaagtccaatacatggttcaaga
tattcaccagttattaaagaatcacgagaaatttatagttcgggatccttaaagagatct
cggtctccagatcgaatggcatatcgaagcgcgacacaaagtcctgtcaatagaagtttc
agtccaagaaacaacgacagagataatagttataataggaaggattttacagataatgga
acagttgataccagtagtaatgttagagtatcttcgatggttggtggaacatccagaaga
gattcatgggatgctatagaaaagacaaaatctttactatcttacggtagtttagaatcc
cttgctaatttaactaataattctgctatggctgaaaataattcaaattattttaacaac
aattataaacaagattatagttcaaaaaatattttgcaaactcataataattctcccaat
ttgattcagaaagtttcaacgtcagaatacaacatatctcaaaaatataacaatgaaaat
cacaatattcgcacgcaaacgcatggaattcttaaaaataaaaataataattattataaa
aatgtggatatcacagatggagttcatgaacgatattttaataatgtaatttctagttca
tcaacacaagataggaattacgaatttgtaactggaagtgcattagagacattaccgatt
catagaccggctacctttacaatcgatcaaaatatagatgctagtaaagtcactgttaat
gtttgtggtccaagtggtaaaataattccaatacaaaaatcaactcttcgaggtttaacg
tattcaataaccgctcaagaagttggagaacatattattcaaattttagtaaatggccaa
catattcaaggctcacctttcagatcgcaagcatacaatgctcatgctattcaagttgga
aacattccgaatggtgttgtcaatcaaccagtagaatttgaaattgatggatccaatgcc
ggatctggaaatctagaaatccttgtaaatggtggtcatgtaactagttttgttagagca
ctgggtagtcaacgatttttggcatcatttgtacctcatgaagctgttgtacatctcgta
gaaatgacattcaatggtgaagttgttcctgggtcaccctggcgtgtgggcattatgcca
gtaccaaaaatgtcagtgattggagattccataagattggttcctgctggtagtccagca
ttttttgaactttctgctcttggcttcaatagtaatgaaattgatgtacaaattataaca
ccttctaaaagatatatacaagcaaaaattgatgaagtatcaggaagatctggagaattt
cgtgttgaattcactccaatagaagtaggtagtcatcttgtagaagtaaccattgctgga
caaaagctaccggcaggaccactagttgctaaggtgtacaacagcagtttgattcaagtt
actgatgtccccagtgctgttgtaggacatgcctgccaatttagagttgatgctagtgct
gctggtgaaggacaacttgaaatttctataaatgaaggagaagtaccaaatcatgttcaa
gtagttggaggaggacgttgtcttgtttcttttacaccagaaactgctaaatcacattat
attgacataaaatttaatggagaagctgtgaaaggatgtccttttatttgtaatgtatct
gatactagtagagtaacattaagtttaaatcatctggaattaattccagtggatcaacct
gctagttttcatatgggtgttgatggtagtggtaatgcagaacttgcagtttctgtaaaa
ggaccaaattgtgaattacctgtcaaggtaactggagatataaaaaatggttttactgca
gaatttattccaagagatgttggtgttcattcaattagtgttgaatataatggccatgct
gtaaatggtacaccatttttagcaaaggcatttaatgcagataaagtattaattggtcct
gtagctagaggtagtgttggccaaccaacacattttactgttgatgcaagtcaagctggt
gaaggaaatttagaaattacgatatcggctcgtaatcaaaacatacctactcaagtcacg
ccacaaggaaatgctcgattttcagttagttttgttccgtttgaagcgtgcgaacatata
attaatatagccttcaataaacgaacagtaccaggttgcccaattataactcgagtaggt
ggtgatagtcatgtaacagtgagtgggcaggcattaagcagtgctggattaggacgacaa
agttatcttactatcagtaatgttgccggtagcttggaagatttagaagttaatgttgaa
ggacccaatggacaggccgtacccgctcaagtcactgacaacaaagatacaacatgcagt
gtagcatttacaccaagagtagttggagaacatagaatttcagtaagtcatcggaatgtt
cctgtgattggtagtccatttagctgcaaagtatatgatgtgactgctattaaagtgaag
gatgctaaacatggtgttattggaatgcctgttactttcttagttgagactagtcaggca
ggaccaggaaatctagaagtgacagtaaacggaggtcgtgtacctacgtctgctcaagct
caaggaccacatacatatgcaatatcattcacgcctcgtgagccaatcgttcatactgtg
gatttaagatttaatggagaggatgtacctggtagcccctttagttgtcaagtgagtgat
acagcaaaagtgataataacagaagggcttgaaaaagtatctgtaaatcgattaacaaca
tttacgatagaagcagatatatcattaggaactcctattgtagaagttctctcaccaact
agagaaagtttaccaatacatgttaagcaaagtggtcatggatgttacactgcaggattc
acacctaaagatgttggcgatcatagtgttgaagtgaaaataaatggattacatgtagaa
ggtagcccatttttagtaaaagcttacaatgctgataaagtaaaagtaacagatataaat
agtggcattgttggtaaaccagttttctttagcattaatgctagtcaagcgggtgctggt
aatcttgaaattattgttgctgtaaatggtaaaaatgtaccgaattacgtacaaagcgaa
gganangcnaagtttagagttaattttaaaccacaagaagctgctgtacacagtcttagt
gttcgatttaatggagaacctgtcccaggttcaccattcagctgtaaagtagttggtgcg
ggtcaagctataattattggtcataatctaaaaatgggagcagtaaaacaattaatgtct
tttattgtggatccacaagctctctcaacaaattgtgatgtaatcgtaacaccaccatca
aacatatcacttcctattacaatagaacctgtagatggaaaatataatatcagttttgtc
cctgtggaagtgggcagacataatattagcattttagttgacagtgaacatgtaaaaggg
tctccatttgcttgcaatatttatgatgttacaaaggtacatgtatcaggtcttacagaa
gcattgttaggtcaagctacaacatttactgttgatgctgctgaagctggtgaaggcaca
ctagaattagtggtgagcacagagaataatacagttaaagctgaagtagttgcttgtgct
cgtggattatatgatgtaacatttgttccacaaactactagtactcattacgttaatatc
agtttcaatgatgataatgtaccaggaagcccgtttaaatgtccaattattagtacaatg
ttagatggaccatctatgattcgtgttggaaatacagcatacatggacttagaaatgcca
ggattagaaggacctgtttctgctgaagttacaggtcctgatagtataattattccatgc
acattgatgaaattatcacccaatttatatcgagtagaaattcgaacacgacaggtcggt
acttacagcgtaatattcagtgatggtcataaaatgattagttcccaaacacttcaagct
ttcgattctggaaaagtaacaattaaagaaatatcggatgtagtttgtcatcgaccaggg
actattacagtggttgtatcaaaagaagctggtcctggaaaattaactgtaaatgtacgt
gcagcaggtgctgatgttgatagtgtaattagagaaggagaaaatggtcaatatgacata
attttccatcctacacgagctgctcctcataaagttcatataaaatacaatgaagttcat
atattgggaagtccattagatttgacagttcgtggtcctactggaggtagagaagtcact
gcaactggattaggattataccaatcatgtgttaataaagtaacatcatttactattgaa
actttaggaagtcctggaaaagaatttgatgtagtaatcagtggaccacaaggtaatgca
gttccagttcgatgttatcaacatcgagatggaaatttgcttgctgagtttactacaagt
actgttggtacttataaaattgacgttttacaaggtacaaaaccagttttgggttcacct
tttttttgtcaagcttttgatgtttctaaagtaaaactacaagaattaggaccaatgaca
gtatcagtacatgatcatatcgttttcaagataataaaaacagatgctggaatggcagat
ttggatgtagtagcaacaagtccattaggtcaagagctgccattacaagttactccactt
aatgatggtgctgaaatggttgaattttctcctagtgtacctggtacatacatgattaat
attacatatgggggatatccaataccagatagtccattagtatgtacagttgatgcggct
ggtcaagctcgtgcaaagggagaaggtttattaagtggtcatgtagataaaacagcgcat
tttattgttactggtacaagaagtccgccagcagttcaggtagatggtccggatagtgtt
tcgaaagcagttattgaagcgggagccaatccaggtacttggaatgtgtcttatattcct
actgaagctggagtattcgatattagaattgtttctgctggtcaacaacttccaggatct
ccgtggcatccaaaaataatagatacaagaaatcttcgcgtaatcgggggttggccagct
gtatgtgatgatgttggacgattgaaaatacatccatcaaataaaattagttttgacact
gctgaagctggacctggtgaacttactgggaaaataggagatcatacattatcttttgaa
atgacatcaaataatagattgaaacttattccaccaaaattaaatggtggagaatatcgt
ttagaaatattctttaatggtatatctttcccaggtgctccaaaattagtaattgttcaa
gatttagaaacacctatacaagatacaagtcgagttttattaagaggaagaggactaaca
tcagcaaaatgtggagaggaagttagtttcacaatagatggttctcaggctggtacagga
acaccaaaagttcaacttttttcaccaaccagcgagcttaatgtaatgttacaacattta
ggtaaatatattattatcttttatataccattaactcccgatcctcttttaatgactgta
tcttggaatggaagacaattgaagggttgccctttacaaataaatgtaacaaacgcagct
gatgcatctcgagttatttgttccggagatggattaaaacatggaatagttggtcaagaa
ataagaagttttattgatacaagacgtgcaggtcctggtgaattaacggcccattgtgtt
ggtccgcataaagtagcttactgtgaattatatgatcacggtgatgcaacgtttacatta
aatgtaaaacctcaagaagctggacgccatgcactaacaattaagtatgctggagaacat
gttcccggttctccttttacgctacgtgtttccggagcaccggatgcttcaaaggttcga
gtttatggaccaggaattgaacatggagtattagcaacatttcaatcacgattcatttgt
gatactcgtggggcaggagctggtcaacttacggtgagagttcgtggtcctaaaggagcg
tttagagtagaaatgcaaagagaaactcaaaaggatcgtataatactttgtcgatatgat
ccaacggaaccaggcgattatagagtcgaagttcgttgggcaggcgtcctcgtacctggt
tctccatttcccgttaaaattgtcgatactcaagatgaattattaatgttgacacagaat
ggagataattattcaacaggacatcatactattgcctcatggcaataa

DBGET integrated database retrieval system