KEGG   Apis mellifera (honey bee): 410228Help
Entry
410228            CDS       T01057                                 

Gene name
Pka-C3
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit PRKX
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     410228 (Pka-C3)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   410228 (Pka-C3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BEEBASE: 
Position
LG10
AA seq 308 aa AA seqDB search
MEWIDNTCTGTFGRVVLCRHQGTPLALKILSMVDVIRLKQVEHVRNEITVLKEVNHPFIV
NMLWSGRDEARVYMLLEFVAGGELFSYLRAAGRFSGPTSCFYAAEIVCALEYLHSKHIVY
RDLKPENLLLDSQGHLKITDFGFSKKLTDRTWTLCGTPEYLAPEIIQSKGHNKAVDWWAL
GVLIYEMLAGFPPFFDDNPFGIYEKILSGRIEWPKHMDPIAKDLIKKLLIADRTKRLGNM
RQGADDVKRHRWFKLVEWPLVPQRALTPPIRPRVKAPGDPSCFDDYPETDWRSQPPLPPE
QLALFQDF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaatggatcgataacacgtgtacaggcactttcggaagagtggtgttatgcaggcat
caaggtactcccctagccttgaagattctctcgatggtggacgtgatcagattgaaacaa
gtggaacacgtacggaacgagatcaccgtactgaaagaggtcaatcatccctttatcgtg
aacatgctttggagcggaagggacgaggcaagagtatacatgttgctagagttcgttgcc
ggtggggagcttttctcctatttaagggcagctggccgattttccgggcccaccagctgc
ttctacgcggccgaaattgtttgtgcattggaatacctgcacagcaaacacatagtttac
agggatttgaaacctgagaatcttttgttggacagccagggacacctgaagatcaccgat
ttcggattttcgaagaaactgacggacagaacgtggactctgtgcggcacaccagaatat
ttggcgccagaaataattcagagcaaaggacacaataaagcggttgactggtgggcgctt
ggtgttctgatctacgaaatgttggccggttttccgccatttttcgatgacaatccgttt
ggcatctacgagaagatattgagcggcaggatagaatggccaaaacatatggatccaatc
gcaaaggatttgatcaaaaaacttttaattgcagatcgtacgaaaagattaggaaatatg
aggcaaggtgccgatgacgtgaaaaggcatcgttggttcaaattagtcgaatggccgttg
gtacctcaaagagctcttacacccccgataagaccacgagtgaaggcaccaggggatcca
agctgtttcgacgattacccggaaaccgattggcgttctcagcctccgttgccgccggaa
caactggctctgtttcaagatttctaa

DBGET integrated database retrieval system