KEGG   Apis mellifera (honey bee): 410270Help
Entry
410270            CDS       T01057                                 

Gene name
AChE-1, ACE1, GB18414
Definition
acetylcholinesterase 1
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    410270 (AChE-1)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     410270 (AChE-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG11
AA seq 657 aa AA seqDB search
MPRNRNSLTKFEVLMVLSLTVLVQLDVCRCTPSHRSRHHADMSYEDTMSFRSGEELPRPA
ALNSNDDPLIVQTRKGKVRGKTMTATTGKEVDAWFGIPYAQKPLESLRFRHPRPAERWSG
ILNATTLPNSCVQILDTVFGEFAGATMWNPNTPLSEDCLYVNVVVPRPRPTNAAVMVWIF
GGGFYSGSATLDVYDHKTLVSEEKVILVSMQYRVASLGFLYFGTPDVPGNAGLFDQVMAL
EWVRDNIAAFGGNPDNVTLFGESAGAVSVSMHLLSPLSRHLFNQAIMQSGSPTAPWAIIS
REESIVRGIRLAEAVGCPHDRDNLQEVIDCLRVKDPVELVKNEWGTLGICEFPFVPVIDG
AFLDETPQRSLATSSFKKANIMMGSNTEEGFYFIIYYLTELFHIDGSEVKVSREQFISAV
SELNPYVNQFGRRAIIYEYTDWLRPDDPHANRDALDKIVGDYQFTCNVNEFAGRYTDTGN
TVYMYYYKHRSMNNPWPRWTGVMHADEISYVFGEPLDPTKGYTPEEVNLSKKMMRYWANF
AKTGDPNVGDVDVWTQAYWPPHTAAKKEYMTLDTNSSEIGNGPRVRQCIFWKNYLPQLVA
GTSKLEPKETCSGTRVNDGGRLLLVLSLVVIGTLFSHRIATRAYDELPEIFDPKGFV
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgccgagaaaccgaaattccttgaccaagttcgaggtgctgatggtgctaagcttaacg
gtgcttgttcagctggatgtgtgcaggtgcaccccgtcccacagaagcagacatcacgcg
gacatgtcgtacgaagatacgatgagctttcgaagcggcgaggaattgcccagaccggcc
gccctcaattcgaacgacgatccactgattgttcagacaagaaagggcaaggtcaggggt
aagaccatgaccgccaccacgggaaaggaggtcgacgcctggttcgggatcccttacgcg
cagaaacctctcgaatccctgaggtttcggcatccaaggccagctgaacgttggtcgggt
atattgaacgccaccacgttgcccaacagctgcgtacaaattctggacaccgtgttcggt
gagttcgcgggcgcgactatgtggaatccgaacacgccgttgagcgaggattgcctttac
gtgaacgtcgtcgttccacgtcccaggcctaccaacgctgctgttatggtatggatattc
ggtggtggtttctattccggatcggcaaccctggacgtttacgatcacaaaaccctggtg
tccgaggagaaagtgatcctggtctcgatgcagtatcgcgtggccagcctcggtttcctc
tacttcggaaccccagacgttcctgggaacgcaggcctcttcgatcaggtgatggccctc
gagtgggtccgcgacaatatcgccgcgttcggcggcaatcctgacaacgtcacgctgttc
ggggagagcgctggtgccgtttcagtttccatgcaccttctttcgcctctctcaaggcat
ctgttcaaccaggcgatcatgcaatcgggttcgccgacggcaccctgggcgatcatctcg
cgcgaggagtcgatcgtgcgagggatcaggttggcagaggcggtcggttgtcctcacgat
cgggacaacctgcaggaggtgatcgattgcctccgcgtcaaggacccggtcgagctggtg
aagaacgagtgggggacgcttggtatctgcgagttcccgttcgtcccagtgatcgacggc
gctttcctcgacgagacgccgcaacgatcgttggccacctcctcgttcaaaaaggcgaac
atcatgatgggatcgaacaccgaggaaggtttctactttatcatttattatctgaccgag
ttgttccacatcgacgggtccgaggtaaaggtgagcagggagcagttcattagcgccgtt
tccgaattaaacccgtacgtcaatcaattcgggaggcgtgccattatctacgagtacacc
gactggctccgccccgacgatccgcacgcgaatcgcgacgcgctggacaaaatcgtcggc
gattatcagttcacttgcaacgtgaacgagttcgccggccgttacaccgacactgggaac
accgtttacatgtattattataagcacagatcgatgaacaatccgtggccgagatggacc
ggcgtgatgcacgctgacgagatcagctacgtgttcggcgaaccgttggatccgaccaag
ggttacacgcccgaggaggtgaatctgtcgaagaaaatgatgaggtattgggcgaatttc
gcgaaaacgggggatccgaacgtaggggacgtggacgtgtggacgcaggcgtactggcca
cctcacactgccgcgaagaaggaatacatgacgctggacacgaacagctcggaaatcggg
aatgggcctagagtgaggcagtgcatattttggaaaaactatcttccccaactggtcgcc
ggcacttcgaagctggagccgaaagagacgtgcagcggtacgagagtgaacgacggcgga
cggttgttgttggtgttgagcctggtggtgatcggcacgctgttcagccacaggatcgcg
acccgcgcgtacgacgagctaccggagatattcgatccgaaagggttcgtctag

DBGET integrated database retrieval system