KEGG   Apis mellifera (honey bee): 410325Help
Entry
410325            CDS       T01057                                 

Gene name
GB16864
Definition
enoyl-coA-hydratase
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
ame  Apis mellifera (honey bee)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    410325 (GB16864)
   01212 Fatty acid metabolism
    410325 (GB16864)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    410325 (GB16864)
   00650 Butanoate metabolism
    410325 (GB16864)
  Lipid metabolism
   00062 Fatty acid elongation
    410325 (GB16864)
   00071 Fatty acid degradation
    410325 (GB16864)
   01040 Biosynthesis of unsaturated fatty acids
    410325 (GB16864)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    410325 (GB16864)
   00310 Lysine degradation
    410325 (GB16864)
   00380 Tryptophan metabolism
    410325 (GB16864)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    410325 (GB16864)
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     410325 (GB16864)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     410325 (GB16864)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG11
AA seq 764 aa AA seqDB search
MLQYRLLGAFANVSHINKNISTRTALYKSMRGMSLSTNLKHLKYKVVDNVAVLTLDSPGV
KMNILNSEVMYEIDDVLKNIEQNSAVNSIIFISGKPGCFIAGADINMIRSFKTPEDGYKV
AFEAQKIFEKIEKSKKPIVAAIQGSCLGGGLELAMACHYRIAVNDQKTSLGLPEVMLGIL
PGAGGTQRLPQLVSLSNSLNMILTGKQVKAIKAKKIGLVDLLVNCLGCGIGTSEENTMRY
LEETAIKVAQDITNKTLKINRDSKTLSDKFMNYVLHFDFVKDQVFNLAKEKVKQKTGSLY
PAPFKILDVMRISLNKESKLGYEAEAKAFGELGVTPQCKGLTNLFFGQTTCKKNRFGVPK
NAVKKIAVVGAGLMGAGIVQVSIDKDFDVIMKDTNETALYRGVNQVQKGMHAAVKKKKYS
NFQKDRYFSKLDSTLDYSSFKNADIVIEAVFEDITIKHKVIKEIEENTPNYCVLATNTSA
ISINEIAAGSNRPDKIIGMHYFSPVHKMQLLEIITHKGTSTETIKTAVDVGLKQGKTIII
VGDGPGFYTTRILSALLSEAIRLMQEGVDPIYLDNLTKKFGFPVGAATLSDEVGIDVGAH
ISTYLVKELGERFHGGDINILNDMVKAGFLGRKSGKGIYTYETNVKNKNVNLLALDILKK
YKLEPKGNTTIEDRQLRMVSRFVNEAILCLEENILANPLEGDIGAVFGLGFPPFTGGPFR
WVDSYGADNLVRKMEEFQNHYGDAFKPCQTLYDMASNSSKNFYR
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgttacaatacagattattgggtgcttttgcaaatgtttcgcacattaataaaaatata
tcaacacgaacagcattatataaatcaatgagaggaatgagtttatcaacaaatttaaaa
catttaaaatacaaagttgtggataatgtagcagttcttactttagattctccaggagtt
aagatgaatattttaaattcagaagtaatgtatgaaattgatgatgttctaaaaaatata
gaacaaaattctgctgtaaattcaataatttttataagtggaaaaccaggttgttttatt
gctggtgctgatattaatatgatacgttctttcaaaactccagaagatggctataaagta
gcttttgaagcccaaaaaatctttgaaaaaatagagaaaagtaaaaaaccaattgtagct
gcaattcaaggtagttgtttaggaggaggtttggagttggctatggcttgtcattatcga
attgctgtaaatgatcaaaaaactagtttaggtttaccagaagtaatgttaggtatcttg
cctggtgcaggtggtacacaaagattacctcaattagtatcactttctaatagtttaaat
atgattcttactggtaaacaagttaaagcaattaaagctaagaaaataggacttgtagat
cttttagtgaattgtcttggttgtggcattggaacatcagaagaaaatacaatgagatat
ttggaagagactgctattaaagttgcacaagatattacaaataaaaccttaaaaattaat
cgagattctaaaacattaagtgataaatttatgaactatgtattacactttgattttgta
aaggatcaagtatttaatttagcaaaagaaaaagtgaagcagaaaactgggagtttgtat
cctgcaccatttaaaatcttagatgtaatgcgtattagtttaaataaggaatcaaaactt
ggttatgaagcagaagctaaagcttttggtgaattaggagttacacctcagtgtaaaggt
cttacaaatttattctttggacaaactacttgtaaaaaaaatcgttttggagtgccaaaa
aatgctgttaaaaaaattgctgttgttggtgctggccttatgggagcaggtattgttcaa
gtaagcatagataaagattttgatgtaattatgaaagatacaaatgaaactgctttatac
cgtggtgttaatcaagtacagaaaggaatgcatgctgctgtaaaaaaaaaaaaatattct
aactttcagaaagatagatatttttctaaacttgattctacattagattatagttcattt
aaaaatgcagatattgtaattgaagctgtatttgaagatattacaattaaacataaagtt
ataaaagaaattgaggaaaatacaccaaattactgtgtacttgcaacaaatacatcagca
atttctattaatgaaatagctgctggaagtaatcgtccagataaaataattggaatgcat
tatttctctccagtacataaaatgcaattattagaaataataacacataaaggaacatca
actgaaacaattaaaactgcagttgatgtaggcttaaaacaaggaaaaacaattattatt
gttggagatggtcctggattttatacaacaagaatactaagtgctttattatctgaagct
attaggttaatgcaggaaggtgtggatcctatatatttggataatttaactaaaaaattt
ggatttcctgttggagcagctactttatcagatgaagttggaattgatgttggtgctcac
ataagtacataccttgtaaaggaattaggtgaacgttttcatggtggagatataaatata
ctcaatgacatggttaaagctggttttctaggaagaaaatcaggcaaaggaatatataca
tatgaaactaatgttaagaataaaaatgttaatcttttagcattagatattttaaaaaaa
tataaacttgagccaaaaggaaatacaactattgaagatcgtcaattaagaatggtatct
cgttttgttaatgaagcaatactttgtttagaggaaaatattttggctaatccgttggaa
ggtgatataggagctgtttttggattagggtttcctccatttactggtggaccttttcgt
tgggtagattcttatggtgctgataacttagtaagaaagatggaagaatttcaaaatcat
tatggtgatgcatttaaaccatgtcaaacattatatgatatggcatccaattctagtaaa
aatttttatagatag

DBGET integrated database retrieval system