KEGG   Apis mellifera (honey bee): 410325Help
Entry
410325            CDS       T01057                                 

Gene name
GB16864
Definition
enoyl-coA-hydratase
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
ame  Apis mellifera (honey bee)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:ame01200]
Metabolism; Overview; Fatty acid metabolism [PATH:ame01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ame00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ame00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:ame00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ame00071]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ame01040]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ame00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ame00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ame00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:ame00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG11
AA seq 764 aa AA seqDB search
MLQYRLLGAFANVSHINKNISTRTALYKSMRGMSLSTNLKHLKYKVVDNVAVLTLDSPGV
KMNILNSEVMYEIDDVLKNIEQNSAVNSIIFISGKPGCFIAGADINMIRSFKTPEDGYKV
AFEAQKIFEKIEKSKKPIVAAIQGSCLGGGLELAMACHYRIAVNDQKTSLGLPEVMLGIL
PGAGGTQRLPQLVSLSNSLNMILTGKQVKAIKAKKIGLVDLLVNCLGCGIGTSEENTMRY
LEETAIKVAQDITNKTLKINRDSKTLSDKFMNYVLHFDFVKDQVFNLAKEKVKQKTGSLY
PAPFKILDVMRISLNKESKLGYEAEAKAFGELGVTPQCKGLTNLFFGQTTCKKNRFGVPK
NAVKKIAVVGAGLMGAGIVQVSIDKDFDVIMKDTNETALYRGVNQVQKGMHAAVKKKKYS
NFQKDRYFSKLDSTLDYSSFKNADIVIEAVFEDITIKHKVIKEIEENTPNYCVLATNTSA
ISINEIAAGSNRPDKIIGMHYFSPVHKMQLLEIITHKGTSTETIKTAVDVGLKQGKTIII
VGDGPGFYTTRILSALLSEAIRLMQEGVDPIYLDNLTKKFGFPVGAATLSDEVGIDVGAH
ISTYLVKELGERFHGGDINILNDMVKAGFLGRKSGKGIYTYETNVKNKNVNLLALDILKK
YKLEPKGNTTIEDRQLRMVSRFVNEAILCLEENILANPLEGDIGAVFGLGFPPFTGGPFR
WVDSYGADNLVRKMEEFQNHYGDAFKPCQTLYDMASNSSKNFYR
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgttacaatacagattattgggtgcttttgcaaatgtttcgcacattaataaaaatata
tcaacacgaacagcattatataaatcaatgagaggaatgagtttatcaacaaatttaaaa
catttaaaatacaaagttgtggataatgtagcagttcttactttagattctccaggagtt
aagatgaatattttaaattcagaagtaatgtatgaaattgatgatgttctaaaaaatata
gaacaaaattctgctgtaaattcaataatttttataagtggaaaaccaggttgttttatt
gctggtgctgatattaatatgatacgttctttcaaaactccagaagatggctataaagta
gcttttgaagcccaaaaaatctttgaaaaaatagagaaaagtaaaaaaccaattgtagct
gcaattcaaggtagttgtttaggaggaggtttggagttggctatggcttgtcattatcga
attgctgtaaatgatcaaaaaactagtttaggtttaccagaagtaatgttaggtatcttg
cctggtgcaggtggtacacaaagattacctcaattagtatcactttctaatagtttaaat
atgattcttactggtaaacaagttaaagcaattaaagctaagaaaataggacttgtagat
cttttagtgaattgtcttggttgtggcattggaacatcagaagaaaatacaatgagatat
ttggaagagactgctattaaagttgcacaagatattacaaataaaaccttaaaaattaat
cgagattctaaaacattaagtgataaatttatgaactatgtattacactttgattttgta
aaggatcaagtatttaatttagcaaaagaaaaagtgaagcagaaaactgggagtttgtat
cctgcaccatttaaaatcttagatgtaatgcgtattagtttaaataaggaatcaaaactt
ggttatgaagcagaagctaaagcttttggtgaattaggagttacacctcagtgtaaaggt
cttacaaatttattctttggacaaactacttgtaaaaaaaatcgttttggagtgccaaaa
aatgctgttaaaaaaattgctgttgttggtgctggccttatgggagcaggtattgttcaa
gtaagcatagataaagattttgatgtaattatgaaagatacaaatgaaactgctttatac
cgtggtgttaatcaagtacagaaaggaatgcatgctgctgtaaaaaaaaaaaaatattct
aactttcagaaagatagatatttttctaaacttgattctacattagattatagttcattt
aaaaatgcagatattgtaattgaagctgtatttgaagatattacaattaaacataaagtt
ataaaagaaattgaggaaaatacaccaaattactgtgtacttgcaacaaatacatcagca
atttctattaatgaaatagctgctggaagtaatcgtccagataaaataattggaatgcat
tatttctctccagtacataaaatgcaattattagaaataataacacataaaggaacatca
actgaaacaattaaaactgcagttgatgtaggcttaaaacaaggaaaaacaattattatt
gttggagatggtcctggattttatacaacaagaatactaagtgctttattatctgaagct
attaggttaatgcaggaaggtgtggatcctatatatttggataatttaactaaaaaattt
ggatttcctgttggagcagctactttatcagatgaagttggaattgatgttggtgctcac
ataagtacataccttgtaaaggaattaggtgaacgttttcatggtggagatataaatata
ctcaatgacatggttaaagctggttttctaggaagaaaatcaggcaaaggaatatataca
tatgaaactaatgttaagaataaaaatgttaatcttttagcattagatattttaaaaaaa
tataaacttgagccaaaaggaaatacaactattgaagatcgtcaattaagaatggtatct
cgttttgttaatgaagcaatactttgtttagaggaaaatattttggctaatccgttggaa
ggtgatataggagctgtttttggattagggtttcctccatttactggtggaccttttcgt
tgggtagattcttatggtgctgataacttagtaagaaagatggaagaatttcaaaatcat
tatggtgatgcatttaaaccatgtcaaacattatatgatatggcatccaattctagtaaa
aatttttatagatag

DBGET integrated database retrieval system